SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384176024|ref|YP_005557409.1| from Bacillus subtilis subsp. subtilis str. RO-NN-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384176024|ref|YP_005557409.1|
Domain Number 1 Region: 8-330
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.27e-103
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.000000705
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384176024|ref|YP_005557409.1|
Sequence length 330
Comment 2-oxoisovalerate dehydrogenase alpha subunit [Bacillus subtilis subsp. subtilis str. RO-NN-1]
Sequence
MSTNRHQALGLTDQEAVDMYRTMLLARKIDERMWLLNRSGKIPFVISCQGQEAAQVGAAF
ALDREMDYVLPYYRDMGVVLAFGMTAKDLMMSGFAKAADPNSGGRQMPGHFGQKKNRIVT
GSSPVTTQVPHAVGIALAGRMEKKDIAAFVTFGEGSSNQGDFHEGANFAAVHKLPVIFMC
ENNKYAISVPYDKQVACENISDRAIGYGMPGVTVNGNDPLEVYQAVKEARERARRGEGPT
LIETISYRLTPHSSDDDDSSYRGREEVEEAKKSDPLLTYQAYLKETGLLSDEIEQTMLDE
IMAIVNEATDEAENAPYAAPESALDYVYAK
Download sequence
Identical sequences A0A0A1MGX7 A0A0T8PUM3 A0A125UJJ9 A0A199WK91 L8AMX2 M4KWV3 P37940
gi|470162612|ref|YP_007534387.1| 224308.BSU24050 gi|402776667|ref|YP_006630611.1| gi|384176024|ref|YP_005557409.1| gi|472330788|ref|YP_007663064.1| gi|16079461|ref|NP_390285.1| gi|560129353|ref|YP_008830494.1| gi|449094902|ref|YP_007427393.1| NP_390285.1.22788 WP_004398565.1.12644 WP_004398565.1.12759 WP_004398565.1.1358 WP_004398565.1.16291 WP_004398565.1.18944 WP_004398565.1.2546 WP_004398565.1.25531 WP_004398565.1.27660 WP_004398565.1.2914 WP_004398565.1.32025 WP_004398565.1.32420 WP_004398565.1.32693 WP_004398565.1.35833 WP_004398565.1.54948 WP_004398565.1.54949 WP_004398565.1.56274 WP_004398565.1.56411 WP_004398565.1.57156 WP_004398565.1.57184 WP_004398565.1.57201 WP_004398565.1.5726 WP_004398565.1.57513 WP_004398565.1.64889 WP_004398565.1.6517 WP_004398565.1.69439 WP_004398565.1.71402 WP_004398565.1.71916 WP_004398565.1.76814 WP_004398565.1.78686 WP_004398565.1.79987 WP_004398565.1.80832 WP_004398565.1.81747 WP_004398565.1.84183 WP_004398565.1.87300 WP_004398565.1.88042 WP_004398565.1.89821 WP_004398565.1.90830 WP_004398565.1.93420 WP_004398565.1.95211 WP_004398565.1.99091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]