SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384178083|ref|YP_005563845.1| from Bacillus thuringiensis serovar finitimus YBT-020

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384178083|ref|YP_005563845.1|
Domain Number 1 Region: 34-270
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.62e-79
Family Phosphate binding protein-like 0.00000534
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384178083|ref|YP_005563845.1|
Sequence length 270
Comment ABC transporter substrate-binding protein [Bacillus thuringiensis serovar finitimus YBT-020]
Sequence
MKKVLLSIVSGAVLLLSACSGNSDKEVKALDEKKITVGVTGGPHEQIFEKVKEVAAKDGL
EIDIKVFNDYVAPNVSLDEKSLDVNSYQTKSYLDVFKAERNMKLTEVFSTVTFPMGVYSK
DIKDVKDLKEGDAIAVPNDPTNELRALKLFEKAGVLKVDPKATEKATAKDIIENPKNLKI
VELEASQLPTQLSEVKAAAINTNFALGAKLSPAKDSIFREGKDSPYVNWVVVRTENKDDA
VVNKLKKAYQSKEVKEFIEKKFDGSVLPSW
Download sequence
Identical sequences F0PS59
WP_000757000.1.100241 WP_000757000.1.80964 gi|384178083|ref|YP_005563845.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]