SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|41614837|ref|NP_963335.1| from Nanoarchaeum equitans Kin4-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41614837|ref|NP_963335.1|
Domain Number 1 Region: 8-116
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 0.0000000196
Family Type 2 phosphatidic acid phosphatase, PAP2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|41614837|ref|NP_963335.1|
Sequence length 275
Comment hypothetical protein NEQ040 [Nanoarchaeum equitans Kin4-M]
Sequence
MISFISYIPLLLVLYDIYRHWDSEKFFHYFNLLLGTIAITITAKMMFHVYRVSHIDPYAF
PSGHTLIASVLLMFYKDVKLVVFPLLVGLLRVILGRHTIEQIILSFLFIPIIYWFVSFLE
SKGKEGNRKIFHIASAMAIAFMFDVFNSIALYVLFALLIIGLILYKHRNNPIVKRFLDYY
DRDGKGIGAFTLVLGSIIYYFIEPKLMVYQAWVDGLASLSKNICFVLLYGYIGSIIGFLV
TKMPIGFLFPIAEALTPYDNILLPILMGVIFFIYH
Download sequence
Identical sequences Q74N51
228908.NEQ040 gi|41614837|ref|NP_963335.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]