SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|41614848|ref|NP_963346.1| from Nanoarchaeum equitans Kin4-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41614848|ref|NP_963346.1|
Domain Number 1 Region: 3-133
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 1.1e-43
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.00017
Further Details:      
 
Domain Number 2 Region: 135-263
Classification Level Classification E-value
Superfamily Translational machinery components 4.8e-37
Family ERF1/Dom34 middle domain-like 0.00077
Further Details:      
 
Domain Number 3 Region: 266-355
Classification Level Classification E-value
Superfamily L30e-like 0.0000000000000119
Family L30e/L7ae ribosomal proteins 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|41614848|ref|NP_963346.1|
Sequence length 358
Comment peptide chain release factor 1 [Nanoarchaeum equitans Kin4-M]
Sequence
MDEKEKYKLKSLLRQLKSIEGRGTELVSLYIPSNYPIGKILDQLNYEYATAANIKDDTTR
KNVQAALAKIINYLKDFKKIPENGLVIFAGNIAGRGDQDVRLWAIVPPEKSNLKLYRCDS
KFYVEPLEEMLEEKKLYGIVTIDKGEAAIGLIKGRKLIVLDEFESWVPRKHHKGGQSARR
FERLIDQATQEWLQYVAEKARQYFDKYKDKIQGIIIGGSGFAKHDFIEYLPYYYKDKIIA
IVDTGYSDAYGLREALYRAEDKLKELEIEKERKILSDLFKAIALGRKDIALGYEEVKKYL
EQGLVQKIIVMEDFPKLDEILELAEKHNVDVEIIEGGTTEAEQFRPIGIAAFLYYASE
Download sequence
Identical sequences Q74N59
228908.NEQ052 gi|41614848|ref|NP_963346.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]