SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|41614852|ref|NP_963350.1| from Nanoarchaeum equitans Kin4-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41614852|ref|NP_963350.1|
Domain Number 1 Region: 3-248
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.29e-42
Family Extended AAA-ATPase domain 0.00032
Further Details:      
 
Domain Number 2 Region: 258-322
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000231
Family Helicase DNA-binding domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|41614852|ref|NP_963350.1|
Sequence length 344
Comment hypothetical protein NEQ057 [Nanoarchaeum equitans Kin4-M]
Sequence
MPIFKNRFVFSEAYVPSKILHRDDEISLIYTAISPIKQGEKPLNIFIYGQTGTGKTLVTK
YVLSKIGDYIYINCKFAGITKRIESFIREFSLQLGQDFYDLTDVIQYIRDKKLIIVFDEV
DQLSKDLGDEILYTFTRAPGNIGIIGISNNIFFVDRLDPRVRSSLSELEILFKPYNALQL
RDILLERAKEGLYENSYDLAAISYIAAVTAREYGDARRAINLLRLAGEIAERKGKNKIEL
EDAKEAIELEEKDKVKFVIESLPLQSKLVLKSIAELKDTTLGKAYELYYRKSLEKSVTPI
TFRRFVEIVNDLETLGLVSIDFALLNGKRVRKVKTFISPKIIDL
Download sequence
Identical sequences Q74MI0
228908.NEQ057 gi|41614852|ref|NP_963350.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]