SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|41614888|ref|NP_963386.1| from Nanoarchaeum equitans Kin4-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41614888|ref|NP_963386.1|
Domain Number 1 Region: 1-136
Classification Level Classification E-value
Superfamily Ribosomal protein L10-like 3.92e-23
Family Ribosomal protein L10-like 0.0023
Further Details:      
 
Weak hits

Sequence:  gi|41614888|ref|NP_963386.1|
Domain Number - Region: 206-240
Classification Level Classification E-value
Superfamily AlbA-like 0.0111
Family DNA-binding protein AlbA 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|41614888|ref|NP_963386.1|
Sequence length 284
Comment acidic ribosomal protein P0 [Nanoarchaeum equitans Kin4-M]
Sequence
MVNPSKVEEVNRLKDIIKKGKTVAIANIRGIPTRDLQRIRKEVRNLANMRVSKKRLIIRA
LKETGYEDLANELEKEKEVTALLLSTNENIFKIAKIFMEHKVNVPIKAGEIAPKDIVIPK
GITNIPVGPIQTELRALGVKTKVTSGKIEIVEDAVVVKEGEIVSPKVANVLQTLGIKPIE
RQVTLIAAKDEVFYDKQILNTPLDLYIEQLKDAYIKARGLAIELAIPTKEIIDELLIKAH
RSSIGLAIELGIPSKEVIDQILIRAENAAKLLYDEIKDKIENSQ
Download sequence
Identical sequences Q74N82
228908.NEQ091 gi|41614888|ref|NP_963386.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]