SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|41615130|ref|NP_963628.1| from Nanoarchaeum equitans Kin4-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41615130|ref|NP_963628.1|
Domain Number 1 Region: 165-300
Classification Level Classification E-value
Superfamily DNA primase core 0.00000000034
Family DNA primase DnaG catalytic core 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|41615130|ref|NP_963628.1|
Sequence length 371
Comment DNA primase [Nanoarchaeum equitans Kin4-M]
Sequence
MAKFAPVQYKYIIKAEFEIDGIVDREDIIGAIFGQTEGLLGMELDLRELQKQGKLGRIEV
EYKRVGNKTIGTITIPTSLKAVETSLIAAAIETVDRVGPAKARFRVKEIVDVRSSKREYI
RNRAKELFVQLLSKTAPDIEELRRELEEAYYSKQLIEYGEEKLPAGPLVEKSDEIILVEG
RADVVNLVKHGILNVLGMNGINIPKSVVELSKRKKVTLFIDGDRGGELVLRNLLAAGADI
DYVAVAPPGREVEELTNKEILKALKSKIPLEQYIKNLRISINNDENKEKYKELLSKVFDT
KKAIVFDEQFNIIDEKPLEEIDKLPSAYGIAIDKILDNETYAKIKGKYQLILALDSNVNA
QERVITLKDIQ
Download sequence
Identical sequences Q74MB1
NYSGXRC-10411k gi|41615130|ref|NP_963628.1| 228908.NEQ341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]