SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|41615265|ref|NP_963763.1| from Nanoarchaeum equitans Kin4-M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41615265|ref|NP_963763.1|
Domain Number 1 Region: 91-192
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 1.83e-19
Family Ribosomal protein S3 C-terminal domain 0.00079
Further Details:      
 
Domain Number 2 Region: 14-100
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 0.0000000000118
Family Prokaryotic type KH domain (KH-domain type II) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|41615265|ref|NP_963763.1|
Sequence length 236
Comment hypothetical protein NEQ481 [Nanoarchaeum equitans Kin4-M]
Sequence
MQKALQMASKVIRKFIQNAKLTVFSQEFIRLYLRGANVSKVIIRQTPIVNRVIIYSARPK
MISEERKAHLAKLLELKFGLEKPVIEVLPIENPNLDAHVIAERLAMGIERNIRAYRRLAQ
RYLETIMNAGAIGAEIVIAGRLSGQRGKTWRFKAGNLRKTGTIGQFELDRAFNIAYLKPG
VAGIHVTILKPDAEIPDIIEFKSPEEISIEEIEKIDKEIAEKMKKYLETYLLAKQM
Download sequence
Identical sequences 228908.NEQ481 gi|41615265|ref|NP_963763.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]