SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001016266.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001016266.1.99540
Domain Number 1 Region: 35-104
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000563
Family Cold shock DNA-binding domain-like 0.00054
Further Details:      
 
Domain Number 2 Region: 123-171
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000163
Family Retrovirus zinc finger-like domains 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001016266.1.99540
Sequence length 195
Comment protein lin-28 homolog A isoform 2 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MGSVSNQEITGGLPKSLDETADIHKSDESLIFQGSGVCKWFNVRMGFGFLTMTKKEGTDL
ETPVDVFVHQSKLHMEGFRSLKEGESVEFTFKKSSKGLESTRVTGPGGAPCIGSERRPKV
KGQQKRRQKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSPNHMVAQCPAKASQAANLEE
QPISEEQELIPETME
Download sequence
Identical sequences B4F6Z2 Q5EB47
8364.ENSXETP00000026953 gi|195539672|gb|AAI68066| gi|59809410|gb|AAH90084| gi|62858881|ref|NP_001016266| gi|82230981|sp|Q5EB47| gi|89266719|gb|CAJ82571| NP_001016266.1.99540 XP_017946715.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]