SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001092901.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001092901.1.92137
Domain Number 1 Region: 47-189
Classification Level Classification E-value
Superfamily C-type lectin-like 1.48e-34
Family C-type lectin domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001092901.1.92137
Sequence length 196
Comment C-type lectin domain family 1 member B isoform b [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MQDEDGYITLNIKTRKPALISAVMQRNYLQGENENRTGTLQQLAKRFCQYVVKQSELKGT
FKGHKCSPCDTNWRYYGDSCYGFFRHNLTWEESKQYCTDMNATLLKIDNRNIVEYIKART
HLIRWVGLSRQKSNEVWKWEDGSVISENMFEFLEDGKGNMNCAYFHNGKMHPTFCENKHY
LMCERKAGMTKVDQLP
Download sequence
Identical sequences NP_001092901.1.87134 NP_001092901.1.92137 XP_011518987.1.92137 ENSP00000327169 ENSP00000406338 gi|153252048|ref|NP_001092901.1| ENSP00000327169 ENSP00000406338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]