SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001103151.1.31192 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001103151.1.31192
Domain Number 1 Region: 42-160
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000113
Family Growth factor receptor domain 0.0015
Further Details:      
 
Domain Number 2 Region: 144-196
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000301
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001103151.1.31192
Sequence length 243
Comment R-spondin-2 precursor [Equus caballus]; AA=GCF_000002305.2; RF=representative genome; TAX=9796; STAX=9796; NAME=Equus caballus; breed=thoroughbred; AL=Chromosome; RT=Major
Sequence
MQFRLFSFALIILNCMDYSHCQGNRWRRNKRASYVSNPICKGCLSCSKDNGCSRCQQKLF
FFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLH
RGRCFDECPDGFAPLDETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKP
AKDTIPCPTIAESRRCKMAMRHCPGGKRAPKAKEKKNKKKKRKLIERAQEQHSVFLATDR
ANQ
Download sequence
Identical sequences A8C9U1
ENSECAP00000022385 9796.ENSECAP00000022385 NP_001103151.1.31192 XP_008533982.1.77740 XP_014710751.1.49734 ENSECAP00000022385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]