SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001120848.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001120848.1.92730
Domain Number 1 Region: 50-117
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000157
Family Growth factor receptor domain 0.0049
Further Details:      
 
Domain Number 2 Region: 208-252
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000129
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Weak hits

Sequence:  NP_001120848.1.92730
Domain Number - Region: 114-155
Classification Level Classification E-value
Superfamily FnI-like domain 0.000105
Family VWC domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001120848.1.92730
Sequence length 354
Comment WNT1-inducible-signaling pathway protein 3 precursor [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MRRLLFCTLLMTGLTQLCCRTQGSAPQDSTPGGRPGAALEVYQRTEVCRWPCRCPPQRPT
CPPGVSLVRDGCGCCKVCAKQPGDTCNEAEICDPHKGLYCDYSGDTPRYETGVCAYLVAV
GCEFNRVYYQNGQVFQPHPLFSCLCVSGAIGCTPLFIPKLAGSNCSAAKGRRKTDPPNCG
RGTLQQQNSASYKTMSAYRNLPLTWRKKCLVQATKWTPCSRTCGMGISNRVTNDNANCEM
RKERRLCYIQPCSRNTSQAVKIPRGETCQPTFQLPKAEKFVFSGCSSTQSYRPTFCGICL
DKRCCVPNKSKMITVRFDCPSEGSFKWQMLWVTSCVCQRDCREPGDIFSELRIL
Download sequence
Identical sequences D3Z5L9
ENSMUSP00000076003 ENSMUSP00000076003 NP_001120848.1.92730 ENSMUSP00000076003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]