SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001137375.1.52716 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001137375.1.52716
Domain Number 1 Region: 27-126
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 7.46e-23
Family Insect pheromone/odorant-binding proteins 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001137375.1.52716
Sequence length 130
Comment odorant binding protein C16 precursor [Tribolium castaneum]; AA=GCF_000002335.3; RF=representative genome; TAX=7070; STAX=7070; NAME=Tribolium castaneum; strain=Georgia GA2; AL=Chromosome; RT=Major
Sequence
MKISTLVAILVLAGSAVCADEDNLNTENVQSIEEDCQKETGVSDESLQELSETGDSDDPL
VKKNALCILKAYGVIDDQGEISEDKLEEKLEPDRGKEEAEKVAKSCAVKKDSPEETAHEA
LLCMQQKSQK
Download sequence
Identical sequences D2A055
TC008161 NP_001137375.1.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]