SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001152339.1.34533 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001152339.1.34533
Domain Number 1 Region: 27-139
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-29
Family Pleckstrin-homology domain (PH domain) 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001152339.1.34533
Sequence length 152
Comment pleckstrin homology domain-containing protein 1 [Zea mays]; AA=GCF_000005005.2; RF=representative genome; TAX=4577; STAX=4577; NAME=Zea mays; cultivar=B73; AL=Chromosome; RT=Major
Sequence
MAASLWRAVMGTGAASTNTTDSSGGGVEFWRAPERVGWLTKQGEYIKTWRRRWFVLKQGR
LFWFKESTVTRASVPRGVIPVASCLTVKGAEDVLNRPYAFELSTPRETMYFIADTEKEKE
EWINSIGRSIVQHSRSVTDAEVVDYDSRPGDK
Download sequence
Identical sequences B6UCM9
NP_001152339.1.34533 GRMZM2G128918_P01 GRMZM2G128918_T01|PACid:20827176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]