SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001166482.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_001166482.1.53824
Domain Number - Region: 91-113
Classification Level Classification E-value
Superfamily WW domain 0.089
Family WW domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001166482.1.53824
Sequence length 146
Comment receptor activity-modifying protein 3 precursor [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MGTRSRRPQLLWLLLLCGTCARVCGCNETRMLERLPRCGKTFAERMREVAVWKWCDLSQF
IVFYESFTNCTEEETVVVGCYWPNPLAQGFITGVHRQFFSNCTVDRTHWEDPPDEVLIPL
IAVPILLTVAMTGLVVWRSKRTDQLP
Download sequence
Identical sequences Q8R4C4
ENSCPOP00000012027 ENSCPOP00000012027 NP_001166482.1.53824 10141.ENSCPOP00000012027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]