SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_039201.1.37955 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_039201.1.37955
Domain Number 1 Region: 11-159
Classification Level Classification E-value
Superfamily C-type lectin-like 1.15e-30
Family C-type lectin domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_039201.1.37955
Sequence length 163
Comment C-type lectin gene family protein [Fowlpox virus]; AA=GCF_000838605.1; RF=na; TAX=10261; STAX=10261; NAME=Fowlpox virus; AL=Complete Genome; RT=Major
Sequence
MEEGKPRRSSAVLWMLIPCGSIIIVLSVFVIILSTRPPVPPDIKILYCKEGWVGYNKNCY
FFSEEKNNKSLAVERCKDMDGHLTSISSKEEFKFILRYKGPGNHWIGIEKVDFNGTWKLE
DGSSYDNIVPIKGIGDCAYLSDRSIMSSFCFLPKKWICRIILL
Download sequence
Identical sequences P14371
NP_039201.1.37955 V239_FOWPV gi|9634909|ref|NP_039201.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]