SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_065549.1.14095 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_065549.1.14095
Domain Number 1 Region: 116-223
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000577
Family C-type lectin domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_065549.1.14095
Sequence length 243
Comment A7 [Alcelaphine gammaherpesvirus 1]; AA=GCF_000838825.1; RF=na; TAX=35252; STAX=35252; NAME=Alcelaphine gammaherpesvirus 1; strain=C500; AL=Complete Genome; RT=Major
Sequence
MLAEMLWPAVNMLLPRKALLVDIFFILAATNLMIAAFALGCLAFYKQLVYITIGNLTFPH
QSGDEVIRAMYIPPVNDSVDFNPGFRLSWLNTLSPLSDGPYDSWSQCEICPGRFVGQKAC
YYVPPKTYSFQNCFFACKNISKCFYLYTPQNITDPFFDHTLRDQDIWIGTFFKKLNAALS
TIDNNFDYTAWDELSVYCAYLTRRSRSTVYFTDCTTSKLCLCGQEDFTPAPFYEALTPAP
VHG
Download sequence
Identical sequences O36400
O36400_ALHV1 NP_065549.1.14095 gi|10140972|ref|NP_065549.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]