SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_214296.1.100253 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_214296.1.100253
Domain Number 1 Region: 6-215
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 8.24e-55
Family PP-loop ATPase 0.00000000397
Further Details:      
 
Domain Number 2 Region: 218-311
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 1.61e-21
Family MesJ substrate recognition domain-like 0.0000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_214296.1.100253
Sequence length 317
Comment cell cycle protein MesJ [Aquifex aeolicus VF5]; AA=GCF_000008625.1; RF=reference genome; TAX=224324; STAX=63363; NAME=Aquifex aeolicus VF5; strain=VF5; AL=Complete Genome; RT=Major
Sequence
MNPESRVIRKVLALQNDEKIFSGERRVLIAFSGGVDSVVLTDVLLKLKNYFSLKEVALAH
FNHMLRESAERDEEFCKEFAKERNMKIFVGKEDVRAFAKENRMSLEEAGRFLRYKFLKEI
LESEGFDCIATAHHLNDLLETSLLFFTRGTGLDGLIGFLPKEEVIRRPLYYVKRSEIEEY
AKFKGLRWVEDETNYEVSIPRNRIRHRVIPELKRINENLEDTFLKMVKVLRAEREFLEEE
AQKLYKEVKKGNCLDVKKLKEKPLALQRRVIRKFIGEKDYEKVELVRSLLEKGGEVNLGK
GKVLKRKERWLCFSPEV
Download sequence
Identical sequences O67728
1wy5A 1wy5_A 1wy5_B 2e21_A 2e21_B 2e21_C 2e21_D 2e89_A 2e89_B 2e89_C 2e89_D NP_214296.1.100253 gi|15606915|ref|NP_214296.1| 224324.aq_1887 aae001001887.2 aae001001887.3 aae001001887.4 aae001001887.5 ar_001000718.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]