SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_252870.1.87394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_252870.1.87394
Domain Number 1 Region: 54-213
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.83e-26
Family B3/B4 domain of PheRS, PheT 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_252870.1.87394
Sequence length 239
Comment hypothetical protein PA4181 [Pseudomonas aeruginosa PAO1]; AA=GCF_000006765.1; RF=reference genome; TAX=208964; STAX=287; NAME=Pseudomonas aeruginosa PAO1; strain=PAO1; AL=Complete Genome; RT=Major
Sequence
MPEHAPILPVIAAEVAALAPGFRALSLTVEAAPIVRPEIAGRAVERACQALARGEPDWAE
AHLAAWAEAFRRFGAKPQRTPCSAEALRKRALRDGGLPSIDPVVDLYNAISVQFAIPVGG
ENLAAYAGPPRLVVADGSETFDTLKNGEALDESPDPGEVVWRDDLGVTCRRWNWRQGVRT
RLDASARRMWFILESLPEMPLAALHEAGGLLLDELRLMMPGMRADSRLLCVATESADSV
Download sequence
Identical sequences Q9HWK0
208964.PA4181 NP_252870.1.87394 WP_003112978.1.18653 WP_003112978.1.24879 WP_003112978.1.26489 WP_003112978.1.35480 WP_003112978.1.41773 WP_003112978.1.41871 WP_003112978.1.48413 WP_003112978.1.50653 WP_003112978.1.55347 WP_003112978.1.62357 WP_003112978.1.65066 WP_003112978.1.68857 WP_003112978.1.73455 WP_003112978.1.81771 WP_003112978.1.84715 WP_003112978.1.92175 WP_003112978.1.98600 gi|15599376|ref|NP_252870.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]