SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_508513.1.50509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_508513.1.50509
Domain Number - Region: 42-97
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 0.0191
Family Frataxin-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_508513.1.50509
Sequence length 143
Comment Uncharacterized protein CELE_Y48D7A.1 [Caenorhabditis elegans]; AA=GCF_000002985.6; RF=reference genome; TAX=6239; STAX=6239; NAME=Caenorhabditis elegans; strain=Bristol N2; AL=Complete Genome; RT=Major
Sequence
MSLNLILVALPMLAFAIHIDCSEESTFFYFDNEYNLFLSVQNVTEVNRYIAFKVDTNADE
TTKYMICVQHHMQCLQANVETPDKVVINKKKPSGQVRYLGKNNFLCSFASSDFPNIFQKK
KQLLVSKGVYQEPFVLIKGVNVP
Download sequence
Identical sequences Q9N4V1
Y48D7A.1 6239.Y48D7A.1 Y48D7A.1 NP_508513.1.50509 Y48D7A.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]