SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_593901.1.19918 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_593901.1.19918
Domain Number 1 Region: 41-181
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.31e-27
Family Ypt/Rab-GAP domain of gyp1p 0.0033
Further Details:      
 
Domain Number 2 Region: 159-271
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.85e-16
Family Ypt/Rab-GAP domain of gyp1p 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_593901.1.19918
Sequence length 299
Comment two-component GAP Cdc16 [Schizosaccharomyces pombe 972h-]; AA=GCF_000002945.1; RF=representative genome; TAX=4896; STAX=4896; NAME=Schizosaccharomyces pombe; strain=972h-; AL=Chromosome; RT=Major
Sequence
MPSIDCKRLQKLAPKSPENQSKCISRLRYMVMLDQVESDEGGNSSTRPYVWAVLLNAPPR
NADEYIRYVRQGPSPMAQKIQNDVSRTLVVESQFHSRVSQSSLSRLLNAYVWKRGALYVQ
GMNVLASPFLYACKSENQAFQFFDRLLQNECPLYVLPNIDGVHRGAKLLDKCLEVLDHRL
YTYLLSKGLTAKIYALPSILTLSACTAPLSEALTIWDFLFAYGIHLNILCVIAQMFIFRE
QLIDHPSPMTLLRTFPPLNAKNIMKITILLISKLPPELYNLLARHAWDSEAGVLIDRLT
Download sequence
Identical sequences P36618
SPAC6F6.08c NP_593901.1.19918 4896.SPAC6F6.08c-1 SPAC6F6_08c.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]