SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_694430.1.61165 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_694430.1.61165
Domain Number 1 Region: 72-125
Classification Level Classification E-value
Superfamily E6 C-terminal domain-like 0.00000000000183
Family E6 C-terminal domain-like 0.0022
Further Details:      
 
Domain Number 2 Region: 13-53
Classification Level Classification E-value
Superfamily E6 C-terminal domain-like 0.0000011
Family E6 C-terminal domain-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_694430.1.61165
Sequence length 134
Comment putative transforming protein E6 [Epsilonpapillomavirus 1]; AA=GCF_000841945.1; RF=na; TAX=40537; STAX=40537; NAME=Epsilonpapillomavirus 1; AL=Complete Genome; RT=Major
Sequence
MPYWLPTYNFEGLQCLQCKKALGSLDALKCKNHKYRRVHRGGKPYGMCQICLEALLQLER
QEFPWTLLLPKDFVKVLGRLPGDYCVRCYYCGCVLSDSEKDRHALDHEGYLYVRGRARGR
CYSCSSDGRRPCVF
Download sequence
Identical sequences Q8BDG7
NP_694430.1.61165 VE6_BPV5 gi|23217015|ref|NP_694430.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]