SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_944046.1.33347 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_944046.1.33347
Domain Number - Region: 10-67
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 0.068
Family Frataxin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_944046.1.33347
Sequence length 67
Comment hypothetical protein Aeh1p168 [Aeromonas phage Aeh1]; AA=GCF_000843245.1; RF=na; TAX=227470; STAX=227470; NAME=Aeromonas virus Aeh1; AL=Complete Genome; RT=Major
Sequence
MAQHVVSIYYIDKAYETYYQLPSESGEKILARNLIVTDLSITRDFVTFKYNGKSCYVVNC
KVIAKEI
Download sequence
Identical sequences Q76YS3
Q76YS3_9CAUD gi|38640090|ref|NP_944046.1| NP_944046.1.33347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]