SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000071473.1.91020 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000071473.1.91020
Domain Number - Region: 17-81
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.017
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000071473.1.91020
Sequence length 122
Comment MULTISPECIES: hypothetical protein [Bacillus cereus group]; AA=GCF_002119445.1; RF=na; TAX=1428; STAX=1428; NAME=Bacillus thuringiensis; strain=ATCC 10792; AL=Complete Genome; RT=Major
Sequence
MSNSGADLSVSRLIVANVEEKEYHFIVREHPIVGKFISLFENGKEYGLLDKQIANKDKFI
TSELTKLDYFNIDVLYHTPGWIWIGMDQFGLHAREATYNEVDVIMKLKEDLYYIDVYEEM
KM
Download sequence
Identical sequences A0A0F6J4E0 A0A168BGW7 A0A1B1L708 A0A1C9BUZ5 A0A243AE34 A0A243EX24 M1QGQ6
gi|410675260|ref|YP_006927631.1| gi|452199313|ref|YP_007479394.1| WP_000071473.1.11442 WP_000071473.1.13975 WP_000071473.1.23245 WP_000071473.1.23360 WP_000071473.1.33790 WP_000071473.1.41729 WP_000071473.1.54547 WP_000071473.1.57561 WP_000071473.1.5895 WP_000071473.1.62277 WP_000071473.1.70108 WP_000071473.1.71652 WP_000071473.1.80622 WP_000071473.1.84541 WP_000071473.1.84775 WP_000071473.1.8577 WP_000071473.1.91020 WP_000071473.1.93838 WP_000071473.1.9533 WP_000071473.1.9700 WP_000071473.1.97816 gi|384186954|ref|YP_005572850.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]