SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000093848.1.76740 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000093848.1.76740
Domain Number - Region: 14-64
Classification Level Classification E-value
Superfamily Colicin 0.0471
Family Colicin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000093848.1.76740
Sequence length 81
Comment hypothetical protein [Leptospira interrogans]; AA=GCF_000216375.1; RF=na; TAX=1001586; STAX=173; NAME=Leptospira interrogans serovar Bulgarica str. Mallika; strain=Mallika; AL=Contig; RT=Major
Sequence
MSSFEIFELVMMYTIAGTLAVWTVLGIFALIIASFIWKSRFGLFTTGFVQVFLVAVNTYL
ISKEKYIAVFFVGGLISFVWT
Download sequence
Identical sequences WP_000093848.1.76740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]