SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000141774.1.32522 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000141774.1.32522
Domain Number - Region: 34-83
Classification Level Classification E-value
Superfamily TAFH domain-like 0.000405
Family TAFH domain-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000141774.1.32522
Sequence length 112
Comment hypothetical protein [Bacillus cereus]; AA=GCF_900176895.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=16-00176; AL=Scaffold; RT=Major
Sequence
MTFDELKKNKPTTSWVEYDEDGEFFTEENISATNKVLDTYINNLQKLGNNPTEVEIMQVV
QEVVININELNVEHDNFIETMAREDLYDFIDTAAQIAGLESEEDITEEWREW
Download sequence
Identical sequences A0A1Y6AJ96 A0A229M1W6 C2RZT2
gi|375283001|ref|YP_005103439.1| WP_000141774.1.13299 WP_000141774.1.18840 WP_000141774.1.24377 WP_000141774.1.26499 WP_000141774.1.27334 WP_000141774.1.31685 WP_000141774.1.32522 WP_000141774.1.33061 WP_000141774.1.43762 WP_000141774.1.46746 WP_000141774.1.47097 WP_000141774.1.48164 WP_000141774.1.48311 WP_000141774.1.48599 WP_000141774.1.51087 WP_000141774.1.52756 WP_000141774.1.55057 WP_000141774.1.59773 WP_000141774.1.72514 WP_000141774.1.77576 WP_000141774.1.79658 WP_000141774.1.82986 WP_000141774.1.8923 WP_000141774.1.91404 WP_000141774.1.99266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]