SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000176508.1.67456 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000176508.1.67456
Domain Number 1 Region: 9-226
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 8.38e-66
Family PP-loop ATPase 0.00000000369
Further Details:      
 
Domain Number 2 Region: 318-427
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.92e-31
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.00000103
Further Details:      
 
Domain Number 3 Region: 227-312
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 7.06e-27
Family MesJ substrate recognition domain-like 0.00000361
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000176508.1.67456
Sequence length 431
Comment MULTISPECIES: tRNA(Ile)-lysidine synthetase [Escherichia]; AA=GCF_001912385.1; RF=na; TAX=562; STAX=562; NAME=Escherichia coli; strain=102928; AL=Contig; RT=Major
Sequence
MTLTLNRQLLISRQILVAFSGGLDSTVLLHQLVQWRTENPGVTLRAIHVHHGLSANADAW
VKHCENICQQWQVPLVVERVQLAQEGLGIEAQARQARYQAFARTLLPGEVLVTAQHLDDQ
CETFLLALKRGSGPAGLSAMAEVSEFAGTRLIRPLLARTRGELEQWALAHGLRWIEDESN
QDDSYDRNFLRLRVVPLLQQRWPHFAEATARSAALCAEQESLLDELLADDLAHCQTPQGT
LQIAPMLAMSDARRAAIIRRWLAGQNAPMPSRDALVRIWQEVALAREDASPCLRLGAFEI
RRYQSQLWWIKSVTGQSETIVPWQTWLQPLELPAALGSVQLTAGGDIRPPRADEAVSVRF
KAPGLLHIVGRNGGRKLKKIWQELGVPPWLRDTTPLLFYGETLIAAAEVFVTQEGVAEGE
NGVSFVWRRNA
Download sequence
Identical sequences A0A1Q6BB82 E9XQD4
WP_000176508.1.100531 WP_000176508.1.12944 WP_000176508.1.27585 WP_000176508.1.33896 WP_000176508.1.43918 WP_000176508.1.63330 WP_000176508.1.67456 WP_000176508.1.8517 WP_000176508.1.85336 WP_000176508.1.86731 WP_000176508.1.8873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]