SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000180349.1.52284 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000180349.1.52284
Domain Number 1 Region: 13-85,112-225
Classification Level Classification E-value
Superfamily C-type lectin-like 1.39e-54
Family Sulfatase-modifying factor-like 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000180349.1.52284
Sequence length 226
Comment MULTISPECIES: hypothetical protein [Bacillus]; AA=GCF_000292705.1; RF=na; TAX=1217737; STAX=1428; NAME=Bacillus thuringiensis HD-789; strain=HD-789; AL=Complete Genome; RT=Major
Sequence
MTNDLIQLIDSLMVNIPAGEVVLRDDRIKKEWLVQIQPFLLAKYAVTMELYDAITNSTLN
NFEKNHKPVVNISWNDAIAFCNVLSKIAGLKEYYSISDVGQIVKCNLDSNGYRLPSEAEW
QYACKASTTGYTYGKLLDIAWYNENSNGQIHDVGQKEPNAWGLYDMLGNVWEWCYDLYDE
KVYGSYRIFRGGSWAEAARGCGATCRRRSHPTFHIEDLGFRLARSI
Download sequence
Identical sequences A0A0Q9H2D2 A0A0Q9HE62 A0A160LB60 A0A242Y526 A0A243B711 A0A2B9E032 A0A2B9R8Z7 J3UKF6 J7W5Y9 J8FZT8 R8C9Z3 R8IM58 R8RYX7 R8Y2B5
WP_000180349.1.100497 WP_000180349.1.101838 WP_000180349.1.12935 WP_000180349.1.13269 WP_000180349.1.22084 WP_000180349.1.26459 WP_000180349.1.27446 WP_000180349.1.28599 WP_000180349.1.34537 WP_000180349.1.3546 WP_000180349.1.35769 WP_000180349.1.38325 WP_000180349.1.4355 WP_000180349.1.52284 WP_000180349.1.58712 WP_000180349.1.59384 WP_000180349.1.60526 WP_000180349.1.6241 WP_000180349.1.70667 WP_000180349.1.83666 WP_000180349.1.87705 WP_000180349.1.89145 WP_000180349.1.97821 WP_000180349.1.97830 gi|402559880|ref|YP_006602604.1| gi|434375774|ref|YP_006610418.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]