SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000269430.1.26000 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000269430.1.26000
Domain Number 1 Region: 113-284
Classification Level Classification E-value
Superfamily DNA-glycosylase 1.38e-35
Family DNA repair glycosylase, 2 C-terminal domains 0.0026
Further Details:      
 
Weak hits

Sequence:  WP_000269430.1.26000
Domain Number - Region: 57-100
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0549
Family Type II restriction endonuclease effector domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000269430.1.26000
Sequence length 287
Comment DNA-3-methyladenine glycosylase [Bacillus cereus]; AA=GCF_000832865.1; RF=na; TAX=451709; STAX=1396; NAME=Bacillus cereus 03BB108; strain=03BB108; AL=Complete Genome; RT=Major
Sequence
MWSEHVTLEYPYHFEEVLKRLSFDPLNVIQLDEKVIYVPICIDEEQIVVRLQGIGTVQNP
QFWISSQTGDPEKVMKRMRAIFHWNEPFQDIQNHFLNTSLRPLFETYAYTPIILEFDYFA
CLLRCIIHQQINLKFATVLTEQFVKRYGTEKNGVFFFPTPERVANISIEELREQKFSQRK
AEYIVGLGQSIASSTLNLASIETRAEEEVSAQLLPIRGIGTWTVQNFLMFGLGRKNMFPK
ADIGIQRAVQGLFQLDDKPDDAFLEKVKQECEPYCSYAALYLWKSIE
Download sequence
Identical sequences B3ZQ89
gi|376264442|ref|YP_005117154.1| WP_000269430.1.13221 WP_000269430.1.23873 WP_000269430.1.26000 WP_000269430.1.3699 WP_000269430.1.69323 WP_000269430.1.782 WP_000269430.1.9269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]