SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000335518.1.49831 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000335518.1.49831
Domain Number - Region: 74-94
Classification Level Classification E-value
Superfamily YonK-like 0.0523
Family Yonk-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000335518.1.49831
Sequence length 133
Comment MULTISPECIES: hypothetical protein [Bacillus cereus group]; AA=GCF_000161235.1; RF=na; TAX=526985; STAX=1396; NAME=Bacillus cereus Rock3-42; strain=Rock3-42; AL=Chromosome; RT=Major
Sequence
MCLFGKYWKKLSRLFNRQLDYFLDNKLLPAVERLLFSQNFARFIQRNSKQATEEFIESSR
FQSIICNILKECNTSPFKEIAEQYLGKNVEITVTVGQLTGVIVAVGDDFLILQEGIGTEV
LLPFASIISIKEA
Download sequence
Identical sequences A0A0K6IZA9 A0A243BHF3 C2VNL5
WP_000335518.1.14882 WP_000335518.1.4865 WP_000335518.1.49831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]