SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000335534.1.40034 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000335534.1.40034
Domain Number - Region: 74-94
Classification Level Classification E-value
Superfamily YonK-like 0.0445
Family Yonk-like 0.0061
Further Details:      
 
Domain Number - Region: 82-131
Classification Level Classification E-value
Superfamily YhbC-like, C-terminal domain 0.068
Family YhbC-like, C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000335534.1.40034
Sequence length 133
Comment MULTISPECIES: hypothetical protein [Bacillus cereus group]; AA=GCF_001757685.1; RF=na; TAX=1428; STAX=1428; NAME=Bacillus thuringiensis; strain=GOE2; AL=Contig; RT=Major
Sequence
MCLFRKYWHKLSRLFNRQLDYFLDNKLLPAVERLLFSQNFARFIQRNSKQATEEVIESSR
FQSIICNILKECTTSPFKEIAEQYLGKNVEITVTVGQLTGVIVAVGDDFLTLQEGIGTEV
LLPFTSIISIKEA
Download sequence
Identical sequences A0A243F032 A0A243INZ0 A0A243JCX5 A0A2B2Y4R0
WP_000335534.1.10745 WP_000335534.1.3180 WP_000335534.1.40034 WP_000335534.1.44348 WP_000335534.1.57732 WP_000335534.1.63789 WP_000335534.1.75866 WP_000335534.1.88269 WP_000335534.1.90254 WP_000335534.1.97561 WP_000335534.1.99636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]