SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000335548.1.51681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000335548.1.51681
Domain Number - Region: 74-94
Classification Level Classification E-value
Superfamily YonK-like 0.0445
Family Yonk-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000335548.1.51681
Sequence length 133
Comment MULTISPECIES: hypothetical protein [Bacillus]; AA=GCF_001699805.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=LCR12; AL=Contig; RT=Major
Sequence
MCLFRKYWNKLSRLFNRQLDYFLDNKLLPAVERLLFSQNFARFIQRNSKQATEEVIESSR
FQSIICNILKECTTSPFKEIAEQYLGKNVEITVTVGQLTGVIVAVGDDFLTLQEGIGTEV
LLPFTSIISIKEA
Download sequence
Identical sequences A0A023P0Z4 A0A0E8TBQ5 A0A0K0S2J2 A0A193CMR2 A0A1G1UGE0 A0A242Z1D3 A0A243C509 A0A2A8ZIG4
WP_000335548.1.24795 WP_000335548.1.26872 WP_000335548.1.26965 WP_000335548.1.35694 WP_000335548.1.40430 WP_000335548.1.51681 WP_000335548.1.54142 WP_000335548.1.55077 WP_000335548.1.58586 WP_000335548.1.61243 WP_000335548.1.6475 WP_000335548.1.66999 WP_000335548.1.72484 WP_000335548.1.77567 WP_000335548.1.81570 WP_000335548.1.86374 WP_000335548.1.869 WP_000335548.1.87947 WP_000335548.1.9623 WP_000335548.1.97082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]