SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000340564.1.61126 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000340564.1.61126
Domain Number - Region: 93-128
Classification Level Classification E-value
Superfamily Plus3-like 0.0549
Family Plus3 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000340564.1.61126
Sequence length 152
Comment MULTISPECIES: spore coat protein [Bacillus]; AA=GCF_002118255.1; RF=na; TAX=1405; STAX=1405; NAME=Bacillus mycoides; strain=SB13; AL=Contig; RT=Major
Sequence
MDCMKELMTYSYTLIYKVGEYTSKVRDEELKGILQHHLPYMLQAYNEQVNFQEGENIQHI
TCKQMCPEFPDMDRETDNEYTGDIGIAICYITHLKRLALKFAQVAVEVANPEFRSFLENC
FVKMNRYAYNVWQYVVKKEYKIKHVYENEKFA
Download sequence
Identical sequences A0A1X6QK26 A0A2B2EZZ2 C2Z6X9 J8R527 R8I226 R8PBZ7
WP_000340564.1.100621 WP_000340564.1.11609 WP_000340564.1.16355 WP_000340564.1.6 WP_000340564.1.61126 WP_000340564.1.68550 WP_000340564.1.73952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]