SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000667969.1.65719 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000667969.1.65719
Domain Number - Region: 123-189
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 0.016
Family Frataxin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000667969.1.65719
Sequence length 338
Comment hypothetical protein [Leptospira interrogans]; AA=GCF_000216335.1; RF=na; TAX=1001588; STAX=173; NAME=Leptospira interrogans str. 2002000621; strain=2002000621; AL=Contig; RT=Major
Sequence
MKFFRHSLQNVIQYKVPFLILVFLLPSLIFGETILFKSGERAYGTVIDQDPETVTIIRDG
KRIKLGKSKILKIIFKEIKDEQEIAKIIEIEKKKLNKEGKKSDKEEQLDTIYLEQMIKEN
SYKIVQKRLALLEKYLEERDGDWESYITAKRNPWEPVWKSAILPGWGHNTMRQNGWGVSY
STLFFVSLFSYFGLDAAEKDRTKAYDKKIEKIIGQQFTTDLLLGSNTSTVTSPELNLVFE
FNTLRNLNSLNSIRSDEADYKKAKHTAAGVAIGIYLIQLTHAYFTGKTWAQNNVIQTPTG
ENISEGFGVRGNPLVSKEIAGGVKSIDVGGQMLYTIFF
Download sequence
Identical sequences A0A0F6HUM5 A0A1V2ZQ39 M6K864 N1U975
WP_000667969.1.11890 WP_000667969.1.19821 WP_000667969.1.26477 WP_000667969.1.26822 WP_000667969.1.3128 WP_000667969.1.35956 WP_000667969.1.37254 WP_000667969.1.5165 WP_000667969.1.51687 WP_000667969.1.5446 WP_000667969.1.5678 WP_000667969.1.65719 WP_000667969.1.70155 WP_000667969.1.70913 WP_000667969.1.83052 WP_000667969.1.85034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]