SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000667974.1.382 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000667974.1.382
Domain Number - Region: 123-189
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 0.016
Family Frataxin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000667974.1.382
Sequence length 338
Comment hypothetical protein [Leptospira interrogans]; AA=GCF_001568735.1; RF=na; TAX=173; STAX=173; NAME=Leptospira interrogans; strain=56628; AL=Contig; RT=Major
Sequence
MKFFRHSLQNVIQYKVPFLILVFLLPSLIFGETILFKSGERAYGTVIDQDSETVTIIRDG
KRIKLGKSKILKIIFKEIKDEQEIAKIIEIEKKKLNKEGKKSDKEEQLDTIYLEQMIKEN
SYKIVQKRLALLEKYLEERDGDWESYITAKRNPWEPVWKSAILPGWGHNTMRQNGWGVSY
STLFFVSLFSYFGLDAAEKDRTKAYDKKIEKIIGQQFTTDLLLGSNTSAVTSPELNLVFE
FNTLRNLNSLNSIRSDEADYKKAKHTAAGVAIGIYLIQLTHAYFTGKTWAQNNVIQTPTG
ENISEGFGVRGNPLVSKEIAGGVKSIDVGGQMLYTIFF
Download sequence
Identical sequences A0A0C5X711 A0A0E2D794 Q8F2U6
gi|386074641|ref|YP_005988958.1| NP_712853.1.97817 WP_000667974.1.2069 WP_000667974.1.22580 WP_000667974.1.25470 WP_000667974.1.25773 WP_000667974.1.2987 WP_000667974.1.31178 WP_000667974.1.382 WP_000667974.1.39100 WP_000667974.1.44326 WP_000667974.1.46993 WP_000667974.1.5368 WP_000667974.1.58511 WP_000667974.1.62196 WP_000667974.1.66305 WP_000667974.1.78364 WP_000667974.1.82080 WP_000667974.1.82375 WP_000667974.1.84406 WP_000667974.1.88006 WP_000667974.1.92349 WP_000667974.1.96841 WP_000667974.1.98154 gi|24215372|ref|NP_712853.1| 189518.LA2672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]