SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000667975.1.36759 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000667975.1.36759
Domain Number - Region: 123-189
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 0.016
Family Frataxin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000667975.1.36759
Sequence length 338
Comment hypothetical protein [Leptospira interrogans]; AA=GCF_000306495.2; RF=na; TAX=1193040; STAX=173; NAME=Leptospira interrogans str. FPW1039; strain=FPW1039; AL=Contig; RT=Major
Sequence
MKFFRHSLQNVIQYKVPFLILVFLLPSLIFGETILFKSGERAYGTVIDQDSETVTIIRDG
KRIKLGKSKILKIIFKEIKDEQEIAKIIEIEKKKLNKEGKKSDKEEQLDTIYLEQMIKEN
SYKIVQKRLALLEKYLEERDGDWESYITAKRNPWEPVWKSAILPGWGHNTMRQNGWGVSY
STLFFVSLFSYFGLDAAEKDRTKAYDKKIEKIIGQQFTTDLLLGSNTSAVTSPELNLVFE
FNTLRNLNSLNSIRSDEADYKKAKHTAAGVAIGIYLIQLTHAYFTGKTWAQNNVIQTPTG
ENVSEGFGVRGNPLVSKEIAGGVKSIDVGGQILYTIFF
Download sequence
Identical sequences A0A098MYY9 A0A0F6IEZ0 A0A163Q3L4 A0A1R0JPP2
WP_000667975.1.10099 WP_000667975.1.102083 WP_000667975.1.12132 WP_000667975.1.14181 WP_000667975.1.15012 WP_000667975.1.1506 WP_000667975.1.16487 WP_000667975.1.23514 WP_000667975.1.25259 WP_000667975.1.27867 WP_000667975.1.31926 WP_000667975.1.34735 WP_000667975.1.36087 WP_000667975.1.36759 WP_000667975.1.4308 WP_000667975.1.45262 WP_000667975.1.47686 WP_000667975.1.49027 WP_000667975.1.50856 WP_000667975.1.51531 WP_000667975.1.54587 WP_000667975.1.55852 WP_000667975.1.56629 WP_000667975.1.56812 WP_000667975.1.60409 WP_000667975.1.6171 WP_000667975.1.61777 WP_000667975.1.62172 WP_000667975.1.62202 WP_000667975.1.63688 WP_000667975.1.67411 WP_000667975.1.67421 WP_000667975.1.68799 WP_000667975.1.71461 WP_000667975.1.76063 WP_000667975.1.77178 WP_000667975.1.77874 WP_000667975.1.81113 WP_000667975.1.87965 WP_000667975.1.88138 WP_000667975.1.96306 WP_000667975.1.96462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]