SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000770663.1.7545 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000770663.1.7545
Domain Number - Region: 62-143
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00192
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 
Domain Number - Region: 219-256
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 0.0915
Family Gametocyte protein Pfg27 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000770663.1.7545
Sequence length 269
Comment hypothetical protein [Bacillus cereus]; AA=GCF_000021785.1; RF=na; TAX=405535; STAX=1396; NAME=Bacillus cereus AH820; strain=AH820; AL=Complete Genome; RT=Major
Sequence
MKLLFTYNQQKVRRYLLSLKIQKNAHLLHELLADKKHEEEIYILDCLEHSREIDFNKISE
RAIQQVMAAVSYLEEDSNFPINLDSKTLLEIIMIAEKSLDTDLSCFYTSQLYLMEIFMRM
YRLGISVKDYYPTYLEQDNFEEYDCEESFKSWGDDLIQDMKLHHVEVDSDDQDTLIKYSD
LFHISMDEINRIIENAWSPIGEMLSNIKIADQSFFHSIQNQFDIRMLYQAEEEKLYLFYD
DDTYFPAIKRIEMLLRIFEEIQLTKNIAS
Download sequence
Identical sequences A1BZ67 B7JTF0
WP_000770663.1.58328 WP_000770663.1.7545 gi|218848270|ref|YP_002454934.1| gi|218848270|ref|YP_002454934.1|NC_011777 405535.BCAH820_B0048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]