SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000781161.1.87782 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000781161.1.87782
Domain Number 1 Region: 2-120
Classification Level Classification E-value
Superfamily Kinase-associated protein B-like 1.7e-48
Family Kinase-associated protein B-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000781161.1.87782
Sequence length 127
Comment MULTISPECIES: kinase [Staphylococcus]; AA=GCF_900081615.1; RF=na; TAX=1280; STAX=1280; NAME=Staphylococcus aureus; strain=MSSA; AL=Scaffold; RT=Major
Sequence
MKLYRFSHKTGSYGVTIVEENGDDVLVKVEQVIKHPKQGDLHNPTETEGVFFHERKALSH
FEKRYTKRSQLRDFNVDVLRYEDSLQQAITDLETKLKAQQTKHAEMSLACLARLKEDYSL
QYKENFK
Download sequence
Identical sequences A0A2K0EQN9
WP_000781161.1.100122 WP_000781161.1.14076 WP_000781161.1.19399 WP_000781161.1.20661 WP_000781161.1.22861 WP_000781161.1.23222 WP_000781161.1.30186 WP_000781161.1.31436 WP_000781161.1.32040 WP_000781161.1.33292 WP_000781161.1.33640 WP_000781161.1.3448 WP_000781161.1.35307 WP_000781161.1.38435 WP_000781161.1.39324 WP_000781161.1.42286 WP_000781161.1.43964 WP_000781161.1.46676 WP_000781161.1.47331 WP_000781161.1.48057 WP_000781161.1.48335 WP_000781161.1.51365 WP_000781161.1.55949 WP_000781161.1.5749 WP_000781161.1.62437 WP_000781161.1.64400 WP_000781161.1.69179 WP_000781161.1.70829 WP_000781161.1.74155 WP_000781161.1.7833 WP_000781161.1.78392 WP_000781161.1.7868 WP_000781161.1.84943 WP_000781161.1.87782 WP_000781161.1.92479 WP_000781161.1.9544 WP_000781161.1.97466 WP_000781161.1.98191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]