SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000790772.1.10099 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000790772.1.10099
Domain Number - Region: 49-91
Classification Level Classification E-value
Superfamily Sec7 domain 0.00497
Family Sec7 domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000790772.1.10099
Sequence length 172
Comment hypothetical protein [Leptospira interrogans]; AA=GCF_001568805.1; RF=na; TAX=173; STAX=173; NAME=Leptospira interrogans; strain=56639; AL=Contig; RT=Major
Sequence
MKNKFHRSVFFLVIFNILSQIACIDLYVGGAHIDESGIDSSKTVTKYEWTQRMVEAYSSR
YTSCGFDVFKMEENEFYTLVSLLILGSNEEYNGISFFDMEENLDDLYLSFSSSKTHYFYK
DSLEYCTRTILTSPCQPNPQDQASSLYLAVIRSCLLNPGNSANFWEKGQGNW
Download sequence
Identical sequences A0A0E2CX04 A0A0F6H7F3 A0A0F6IKJ2 M6HH84
WP_000790772.1.10099 WP_000790772.1.22564 WP_000790772.1.23514 WP_000790772.1.24738 WP_000790772.1.25773 WP_000790772.1.31321 WP_000790772.1.3175 WP_000790772.1.36759 WP_000790772.1.46007 WP_000790772.1.46993 WP_000790772.1.47834 WP_000790772.1.49027 WP_000790772.1.55852 WP_000790772.1.58511 WP_000790772.1.69218 WP_000790772.1.70516 WP_000790772.1.7707 WP_000790772.1.81113 WP_000790772.1.82978 WP_000790772.1.92349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]