SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000790774.1.78739 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000790774.1.78739
Domain Number - Region: 48-89
Classification Level Classification E-value
Superfamily Sec7 domain 0.0051
Family Sec7 domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000790774.1.78739
Sequence length 171
Comment hypothetical protein [Leptospira interrogans]; AA=GCF_000246535.1; RF=na; TAX=1049814; STAX=173; NAME=Leptospira interrogans serovar Bim str. P2529; strain=P2529; AL=Scaffold; RT=Major
Sequence
MKNKFHRSVFFLVIFNILSQIACIDLYVGGAHIDESGIDSSKTVTKYEWTQRMVEAYSSR
YTSCGFDVFKMEENEFYTLVSLLILGSNEEYNGISFFDMEENLDLYLSFSSSKTHYFYKD
SLEYCTRTILTSPCQPNPQDQASSLYLAVIRSCLLNPGNSANFWEKGQGNW
Download sequence
Identical sequences A0A0E2D3Y5 M3CS80
WP_000790774.1.14181 WP_000790774.1.18988 WP_000790774.1.20778 WP_000790774.1.24270 WP_000790774.1.37594 WP_000790774.1.39100 WP_000790774.1.41637 WP_000790774.1.46987 WP_000790774.1.50455 WP_000790774.1.51443 WP_000790774.1.5165 WP_000790774.1.6135 WP_000790774.1.69136 WP_000790774.1.73107 WP_000790774.1.74792 WP_000790774.1.76970 WP_000790774.1.77178 WP_000790774.1.78739 WP_000790774.1.90803 WP_000790774.1.92480 WP_000790774.1.96306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]