SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000790780.1.79939 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000790780.1.79939
Domain Number - Region: 49-91
Classification Level Classification E-value
Superfamily Sec7 domain 0.00811
Family Sec7 domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000790780.1.79939
Sequence length 172
Comment hypothetical protein [Leptospira interrogans]; AA=GCF_000244055.1; RF=na; TAX=1049795; STAX=173; NAME=Leptospira interrogans serovar Autumnalis str. LP101; strain=LP101; AL=Contig; RT=Major
Sequence
MKNKFHRSVFFLVIFNILSQIACIDLYVGGAHIDESGIDSSKTVTKYEWTQRMVEVYSSR
YTSCGFDVFKMEENEFYTLVSLLILGSNEEYNGISFFDMEENLDDLYLSFSSSKTHYFYK
DSLEYCTRTILTSPCQPNPQDQASSLYLAVIRSCLLNPGNSANFWEKGQGNW
Download sequence
Identical sequences WP_000790780.1.67421 WP_000790780.1.79939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]