SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000811624.1.73434 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000811624.1.73434
Domain Number - Region: 162-206
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.000458
Family VPS28 N-terminal domain 0.038
Further Details:      
 
Domain Number - Region: 46-191
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0173
Family Capz beta-1 subunit 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000811624.1.73434
Sequence length 225
Comment MULTISPECIES: hypothetical protein [Acinetobacter calcoaceticus/baumannii complex]; AA=GCF_000804805.1; RF=na; TAX=470; STAX=470; NAME=Acinetobacter baumannii; strain=2011SDAB1; AL=Scaffold; RT=Major
Sequence
MKQLLSLLFLIVSSAVHADPTTFQRLLLIDDLEAWLSEGKSLFNWSNVLSKQNNENNSYL
SPSLIYADYANNIFKAESKYNGKIQGIYGPFNNIEKSHDGSPIIVFNVSYTNRFYVTGPS
VSEVLNLNLGTPIKLKCLNFKLSSGGDLKANCSFFTNTNRMIAVNTIQNREYSQKINKLI
NQYNNIFKQVDLKLKDNFVNEINSKCNFIDSTNYDRCMELIHKSI
Download sequence
Identical sequences WP_000811624.1.10838 WP_000811624.1.13516 WP_000811624.1.14187 WP_000811624.1.16011 WP_000811624.1.16785 WP_000811624.1.17752 WP_000811624.1.22349 WP_000811624.1.23328 WP_000811624.1.26528 WP_000811624.1.30856 WP_000811624.1.3162 WP_000811624.1.36517 WP_000811624.1.40297 WP_000811624.1.43340 WP_000811624.1.44342 WP_000811624.1.45637 WP_000811624.1.46338 WP_000811624.1.46739 WP_000811624.1.49639 WP_000811624.1.503 WP_000811624.1.5193 WP_000811624.1.52392 WP_000811624.1.55155 WP_000811624.1.58269 WP_000811624.1.59416 WP_000811624.1.62712 WP_000811624.1.65325 WP_000811624.1.65804 WP_000811624.1.66200 WP_000811624.1.67862 WP_000811624.1.68837 WP_000811624.1.71876 WP_000811624.1.72158 WP_000811624.1.73434 WP_000811624.1.76981 WP_000811624.1.80162 WP_000811624.1.84332 WP_000811624.1.87099 WP_000811624.1.90310 WP_000811624.1.92365 WP_000811624.1.92515 WP_000811624.1.95755 WP_000811624.1.95859 WP_000811624.1.96556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]