SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000880722.1.101283 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000880722.1.101283
Domain Number - Region: 17-74
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0048
Family DBL homology domain (DH-domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000880722.1.101283
Sequence length 91
Comment hypothetical protein [Streptococcus agalactiae]; AA=GCF_000311425.1; RF=na; TAX=1154865; STAX=1311; NAME=Streptococcus agalactiae MRI Z1-023; strain=MRI Z1-023; AL=Contig; RT=Major
Sequence
MLANNKKRKRKFTLFLLMIIYRTFIKSYNKLVKYRKYCIFLENMVYIVNKMMAKLIEFSY
RKIFQKNNFTLKSFDYQINRAFIKILYKYKM
Download sequence
Identical sequences WP_000880722.1.101283 WP_000880722.1.16335 WP_000880722.1.30974 WP_000880722.1.50082 WP_000880722.1.52139 WP_000880722.1.52634 WP_000880722.1.64352 WP_000880722.1.83944 WP_000880722.1.84289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]