SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000939455.1.35026 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000939455.1.35026
Domain Number - Region: 6-67
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0942
Family DBL homology domain (DH-domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000939455.1.35026
Sequence length 77
Comment MULTISPECIES: hypothetical protein [Bacillus]; AA=GCF_900107515.1; RF=na; TAX=1761752; STAX=1761752; NAME=Bacillus sp. 112mf; strain=112MF; AL=Scaffold; RT=Major
Sequence
MLQKENLSDIMRLLAGFLLSLKLLFNSFGINFITNDQIDAIVNVISFLFILYFGYKNNYV
GKKGVEQKKLLKKHNLH
Download sequence
Identical sequences A0A1H4B3F2 A0A1X6QFJ1 A0A2A9RA79 C2ZC39 J8RAX1 R8HHP6 R8NZU7
WP_000939455.1.100621 WP_000939455.1.11609 WP_000939455.1.16355 WP_000939455.1.35026 WP_000939455.1.6 WP_000939455.1.61126 WP_000939455.1.68550 WP_000939455.1.73952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]