SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000999916.1.44144 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000999916.1.44144
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 6.1e-40
Family Frataxin-like 0.00000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000999916.1.44144
Sequence length 106
Comment iron donor protein CyaY [Salmonella enterica]; AA=GCF_000985855.1; RF=na; TAX=54388; STAX=28901; NAME=Salmonella enterica subsp. enterica serovar Paratyphi A; AL=Scaffold; RT=Major
Sequence
MNDSEFHRLADALWLTIEECLDSWDGDSDIDCEINGGVLTLSFENGSKIIINRQEPLHQV
WLATKQSGYHFDLKGDEWICDRSGETFWELLEQAATQQAGEKVSFR
Download sequence
Identical sequences A0A2J1A0E9 B5BIV3 Q5PKM9
WP_000999916.1.101111 WP_000999916.1.101239 WP_000999916.1.101904 WP_000999916.1.11810 WP_000999916.1.12210 WP_000999916.1.12308 WP_000999916.1.12865 WP_000999916.1.13262 WP_000999916.1.13602 WP_000999916.1.13967 WP_000999916.1.15011 WP_000999916.1.15938 WP_000999916.1.16710 WP_000999916.1.18355 WP_000999916.1.19882 WP_000999916.1.20564 WP_000999916.1.2139 WP_000999916.1.21534 WP_000999916.1.22451 WP_000999916.1.22566 WP_000999916.1.24394 WP_000999916.1.25846 WP_000999916.1.26122 WP_000999916.1.26750 WP_000999916.1.30555 WP_000999916.1.31069 WP_000999916.1.31546 WP_000999916.1.329 WP_000999916.1.33420 WP_000999916.1.33504 WP_000999916.1.34424 WP_000999916.1.35331 WP_000999916.1.35507 WP_000999916.1.36057 WP_000999916.1.36586 WP_000999916.1.36875 WP_000999916.1.38452 WP_000999916.1.38620 WP_000999916.1.39112 WP_000999916.1.39953 WP_000999916.1.40031 WP_000999916.1.40688 WP_000999916.1.42098 WP_000999916.1.4229 WP_000999916.1.42372 WP_000999916.1.44144 WP_000999916.1.44606 WP_000999916.1.44687 WP_000999916.1.4505 WP_000999916.1.47023 WP_000999916.1.47061 WP_000999916.1.47110 WP_000999916.1.47243 WP_000999916.1.47542 WP_000999916.1.47660 WP_000999916.1.48134 WP_000999916.1.48510 WP_000999916.1.48768 WP_000999916.1.48841 WP_000999916.1.49430 WP_000999916.1.49494 WP_000999916.1.49790 WP_000999916.1.50153 WP_000999916.1.50529 WP_000999916.1.50750 WP_000999916.1.5185 WP_000999916.1.52101 WP_000999916.1.54340 WP_000999916.1.5462 WP_000999916.1.55200 WP_000999916.1.56070 WP_000999916.1.56374 WP_000999916.1.56791 WP_000999916.1.56942 WP_000999916.1.57244 WP_000999916.1.5761 WP_000999916.1.58467 WP_000999916.1.59068 WP_000999916.1.59276 WP_000999916.1.60809 WP_000999916.1.61309 WP_000999916.1.6143 WP_000999916.1.61694 WP_000999916.1.62063 WP_000999916.1.62195 WP_000999916.1.64758 WP_000999916.1.65475 WP_000999916.1.65818 WP_000999916.1.67228 WP_000999916.1.67825 WP_000999916.1.69433 WP_000999916.1.69839 WP_000999916.1.7060 WP_000999916.1.70662 WP_000999916.1.71848 WP_000999916.1.72121 WP_000999916.1.72254 WP_000999916.1.72797 WP_000999916.1.72946 WP_000999916.1.73102 WP_000999916.1.73958 WP_000999916.1.74741 WP_000999916.1.75371 WP_000999916.1.76115 WP_000999916.1.7784 WP_000999916.1.78959 WP_000999916.1.79531 WP_000999916.1.79977 WP_000999916.1.81041 WP_000999916.1.81084 WP_000999916.1.81568 WP_000999916.1.81798 WP_000999916.1.82692 WP_000999916.1.83280 WP_000999916.1.83806 WP_000999916.1.84814 WP_000999916.1.84872 WP_000999916.1.84879 WP_000999916.1.86466 WP_000999916.1.87220 WP_000999916.1.87276 WP_000999916.1.87376 WP_000999916.1.87891 WP_000999916.1.88817 WP_000999916.1.89764 WP_000999916.1.91282 WP_000999916.1.91312 WP_000999916.1.91331 WP_000999916.1.9166 WP_000999916.1.91984 WP_000999916.1.92646 WP_000999916.1.92786 WP_000999916.1.92842 WP_000999916.1.92936 WP_000999916.1.93118 WP_000999916.1.94071 WP_000999916.1.95133 WP_000999916.1.9628 WP_000999916.1.96731 WP_000999916.1.99073 gi|56415798|ref|YP_152873.1| 295319.SPA3784 554290.SSPA3523 CP000026|CDS_3929081-3928761 FM200053|CDS_3924755-3924435 gi|197364728|ref|YP_002144365.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]