SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000999918.1.35847 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000999918.1.35847
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 6.45e-40
Family Frataxin-like 0.000000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000999918.1.35847
Sequence length 106
Comment iron donor protein CyaY [Salmonella enterica]; AA=GCF_002046345.1; RF=na; TAX=1050190; STAX=28901; NAME=Salmonella enterica subsp. houtenae serovar 48:g,z51:-; strain=96-0265; AL=Contig; RT=Major
Sequence
MNDSEFHRLADALWLTIEERLDDWDGDSDIDCEINGGVLTLSFENGSKIIINRQEPLHQV
WLATKQGGYHFDLKGDEWICDRSGATFWDLLEQAATQQAGEAVSFR
Download sequence
Identical sequences A0A1J6Z297
WP_000999918.1.101088 WP_000999918.1.101543 WP_000999918.1.11386 WP_000999918.1.1232 WP_000999918.1.13980 WP_000999918.1.15667 WP_000999918.1.15944 WP_000999918.1.16563 WP_000999918.1.20153 WP_000999918.1.23219 WP_000999918.1.28665 WP_000999918.1.31590 WP_000999918.1.33050 WP_000999918.1.34364 WP_000999918.1.345 WP_000999918.1.35847 WP_000999918.1.38404 WP_000999918.1.41497 WP_000999918.1.45238 WP_000999918.1.49274 WP_000999918.1.49302 WP_000999918.1.51458 WP_000999918.1.56459 WP_000999918.1.58053 WP_000999918.1.58770 WP_000999918.1.6126 WP_000999918.1.62407 WP_000999918.1.62669 WP_000999918.1.63362 WP_000999918.1.64103 WP_000999918.1.6484 WP_000999918.1.70394 WP_000999918.1.7563 WP_000999918.1.75835 WP_000999918.1.77622 WP_000999918.1.78568 WP_000999918.1.79842 WP_000999918.1.80157 WP_000999918.1.80705 WP_000999918.1.82132 WP_000999918.1.83632 WP_000999918.1.84885 WP_000999918.1.97604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]