SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000999919.1.97477 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000999919.1.97477
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 4.36e-40
Family Frataxin-like 0.000000772
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000999919.1.97477
Sequence length 106
Comment iron donor protein CyaY [Salmonella enterica]; AA=GCF_002062895.1; RF=na; TAX=611; STAX=28901; NAME=Salmonella enterica subsp. enterica serovar Heidelberg; strain=BCW_2830; AL=Contig; RT=Major
Sequence
MNDSEFHRLADALWLTIEERLDNWDGDSDIDCEINGGVLTISFENGSKIIINRQEPLHQV
WLATKQGGYHFDLKGDEWICDRSGETFWDLLEQAATQQAGEKVSFR
Download sequence
Identical sequences A0A232R107 A0A265AZ97 A0A2J5W7V9 B4TB34 G5NKE7
WP_000999919.1.100129 WP_000999919.1.100584 WP_000999919.1.100730 WP_000999919.1.100750 WP_000999919.1.101091 WP_000999919.1.101123 WP_000999919.1.1013 WP_000999919.1.101741 WP_000999919.1.10231 WP_000999919.1.10237 WP_000999919.1.10465 WP_000999919.1.10566 WP_000999919.1.1110 WP_000999919.1.11156 WP_000999919.1.11254 WP_000999919.1.11304 WP_000999919.1.11588 WP_000999919.1.11677 WP_000999919.1.11687 WP_000999919.1.11735 WP_000999919.1.11834 WP_000999919.1.11875 WP_000999919.1.12017 WP_000999919.1.12397 WP_000999919.1.13207 WP_000999919.1.13661 WP_000999919.1.14041 WP_000999919.1.14111 WP_000999919.1.14436 WP_000999919.1.14458 WP_000999919.1.14618 WP_000999919.1.14789 WP_000999919.1.15102 WP_000999919.1.15612 WP_000999919.1.158 WP_000999919.1.15862 WP_000999919.1.15910 WP_000999919.1.15986 WP_000999919.1.16004 WP_000999919.1.16047 WP_000999919.1.16172 WP_000999919.1.16361 WP_000999919.1.16525 WP_000999919.1.16873 WP_000999919.1.16903 WP_000999919.1.17093 WP_000999919.1.17098 WP_000999919.1.17439 WP_000999919.1.17560 WP_000999919.1.17693 WP_000999919.1.17743 WP_000999919.1.17891 WP_000999919.1.17901 WP_000999919.1.1798 WP_000999919.1.18122 WP_000999919.1.1818 WP_000999919.1.18254 WP_000999919.1.19273 WP_000999919.1.19588 WP_000999919.1.19616 WP_000999919.1.19723 WP_000999919.1.19793 WP_000999919.1.19975 WP_000999919.1.20446 WP_000999919.1.20503 WP_000999919.1.20614 WP_000999919.1.20631 WP_000999919.1.20789 WP_000999919.1.21136 WP_000999919.1.21309 WP_000999919.1.21326 WP_000999919.1.21351 WP_000999919.1.21825 WP_000999919.1.21991 WP_000999919.1.22030 WP_000999919.1.22169 WP_000999919.1.22235 WP_000999919.1.22692 WP_000999919.1.22758 WP_000999919.1.22864 WP_000999919.1.23246 WP_000999919.1.23309 WP_000999919.1.23379 WP_000999919.1.2342 WP_000999919.1.23509 WP_000999919.1.23513 WP_000999919.1.23670 WP_000999919.1.23959 WP_000999919.1.24082 WP_000999919.1.24419 WP_000999919.1.24444 WP_000999919.1.2467 WP_000999919.1.25072 WP_000999919.1.25119 WP_000999919.1.26741 WP_000999919.1.26919 WP_000999919.1.26924 WP_000999919.1.26980 WP_000999919.1.27084 WP_000999919.1.27223 WP_000999919.1.27255 WP_000999919.1.27522 WP_000999919.1.27523 WP_000999919.1.27544 WP_000999919.1.27679 WP_000999919.1.28032 WP_000999919.1.28301 WP_000999919.1.28830 WP_000999919.1.29113 WP_000999919.1.29509 WP_000999919.1.29530 WP_000999919.1.29682 WP_000999919.1.29768 WP_000999919.1.29827 WP_000999919.1.29990 WP_000999919.1.30022 WP_000999919.1.30202 WP_000999919.1.30356 WP_000999919.1.30437 WP_000999919.1.3076 WP_000999919.1.3080 WP_000999919.1.31092 WP_000999919.1.31111 WP_000999919.1.31122 WP_000999919.1.31451 WP_000999919.1.31725 WP_000999919.1.32260 WP_000999919.1.33160 WP_000999919.1.33499 WP_000999919.1.33580 WP_000999919.1.3394 WP_000999919.1.34259 WP_000999919.1.34417 WP_000999919.1.35193 WP_000999919.1.3556 WP_000999919.1.35648 WP_000999919.1.35892 WP_000999919.1.36017 WP_000999919.1.36547 WP_000999919.1.37013 WP_000999919.1.37190 WP_000999919.1.38393 WP_000999919.1.38569 WP_000999919.1.38781 WP_000999919.1.38942 WP_000999919.1.39113 WP_000999919.1.39265 WP_000999919.1.39471 WP_000999919.1.39576 WP_000999919.1.39584 WP_000999919.1.39724 WP_000999919.1.40254 WP_000999919.1.40341 WP_000999919.1.40374 WP_000999919.1.40648 WP_000999919.1.40935 WP_000999919.1.40979 WP_000999919.1.40996 WP_000999919.1.41018 WP_000999919.1.42156 WP_000999919.1.4222 WP_000999919.1.42243 WP_000999919.1.42248 WP_000999919.1.42444 WP_000999919.1.42605 WP_000999919.1.42676 WP_000999919.1.42707 WP_000999919.1.4289 WP_000999919.1.42923 WP_000999919.1.43077 WP_000999919.1.43339 WP_000999919.1.43371 WP_000999919.1.43438 WP_000999919.1.43710 WP_000999919.1.43778 WP_000999919.1.43951 WP_000999919.1.44300 WP_000999919.1.44433 WP_000999919.1.44443 WP_000999919.1.44578 WP_000999919.1.44633 WP_000999919.1.44678 WP_000999919.1.44833 WP_000999919.1.44933 WP_000999919.1.44950 WP_000999919.1.44996 WP_000999919.1.45145 WP_000999919.1.45434 WP_000999919.1.45535 WP_000999919.1.45582 WP_000999919.1.45622 WP_000999919.1.45848 WP_000999919.1.46203 WP_000999919.1.46278 WP_000999919.1.46345 WP_000999919.1.46406 WP_000999919.1.46434 WP_000999919.1.46444 WP_000999919.1.46689 WP_000999919.1.4671 WP_000999919.1.46732 WP_000999919.1.46803 WP_000999919.1.46804 WP_000999919.1.47008 WP_000999919.1.47579 WP_000999919.1.47587 WP_000999919.1.47849 WP_000999919.1.48132 WP_000999919.1.49005 WP_000999919.1.49113 WP_000999919.1.49375 WP_000999919.1.49550 WP_000999919.1.49590 WP_000999919.1.49686 WP_000999919.1.50003 WP_000999919.1.50285 WP_000999919.1.50404 WP_000999919.1.50517 WP_000999919.1.50999 WP_000999919.1.51066 WP_000999919.1.51224 WP_000999919.1.51285 WP_000999919.1.51308 WP_000999919.1.51394 WP_000999919.1.51514 WP_000999919.1.51613 WP_000999919.1.51831 WP_000999919.1.52161 WP_000999919.1.52170 WP_000999919.1.52336 WP_000999919.1.52356 WP_000999919.1.52528 WP_000999919.1.52692 WP_000999919.1.52748 WP_000999919.1.52866 WP_000999919.1.52949 WP_000999919.1.52985 WP_000999919.1.5316 WP_000999919.1.53272 WP_000999919.1.53534 WP_000999919.1.53905 WP_000999919.1.54526 WP_000999919.1.54694 WP_000999919.1.5493 WP_000999919.1.55325 WP_000999919.1.55430 WP_000999919.1.55477 WP_000999919.1.55496 WP_000999919.1.55545 WP_000999919.1.5560 WP_000999919.1.55718 WP_000999919.1.55973 WP_000999919.1.56082 WP_000999919.1.56100 WP_000999919.1.56244 WP_000999919.1.56559 WP_000999919.1.56651 WP_000999919.1.56660 WP_000999919.1.56905 WP_000999919.1.57233 WP_000999919.1.57356 WP_000999919.1.57510 WP_000999919.1.57781 WP_000999919.1.58358 WP_000999919.1.58407 WP_000999919.1.59136 WP_000999919.1.59236 WP_000999919.1.59294 WP_000999919.1.59420 WP_000999919.1.59439 WP_000999919.1.60015 WP_000999919.1.60370 WP_000999919.1.6052 WP_000999919.1.60545 WP_000999919.1.60561 WP_000999919.1.60772 WP_000999919.1.61497 WP_000999919.1.61662 WP_000999919.1.62020 WP_000999919.1.6209 WP_000999919.1.62257 WP_000999919.1.63243 WP_000999919.1.63766 WP_000999919.1.63781 WP_000999919.1.63797 WP_000999919.1.63831 WP_000999919.1.64018 WP_000999919.1.64208 WP_000999919.1.64266 WP_000999919.1.6437 WP_000999919.1.64387 WP_000999919.1.64645 WP_000999919.1.64894 WP_000999919.1.65022 WP_000999919.1.65168 WP_000999919.1.65238 WP_000999919.1.65269 WP_000999919.1.65558 WP_000999919.1.6560 WP_000999919.1.6572 WP_000999919.1.65795 WP_000999919.1.65940 WP_000999919.1.65956 WP_000999919.1.66049 WP_000999919.1.66129 WP_000999919.1.66235 WP_000999919.1.66330 WP_000999919.1.66365 WP_000999919.1.66462 WP_000999919.1.66678 WP_000999919.1.66820 WP_000999919.1.67100 WP_000999919.1.67235 WP_000999919.1.6739 WP_000999919.1.67637 WP_000999919.1.67924 WP_000999919.1.68401 WP_000999919.1.68477 WP_000999919.1.6882 WP_000999919.1.69001 WP_000999919.1.69011 WP_000999919.1.6904 WP_000999919.1.69151 WP_000999919.1.69320 WP_000999919.1.69359 WP_000999919.1.6954 WP_000999919.1.69758 WP_000999919.1.69785 WP_000999919.1.69807 WP_000999919.1.70959 WP_000999919.1.71023 WP_000999919.1.7134 WP_000999919.1.71363 WP_000999919.1.71636 WP_000999919.1.71798 WP_000999919.1.71929 WP_000999919.1.72220 WP_000999919.1.72382 WP_000999919.1.72403 WP_000999919.1.72412 WP_000999919.1.72728 WP_000999919.1.72827 WP_000999919.1.72968 WP_000999919.1.73125 WP_000999919.1.73362 WP_000999919.1.73379 WP_000999919.1.73461 WP_000999919.1.73596 WP_000999919.1.73847 WP_000999919.1.73901 WP_000999919.1.74117 WP_000999919.1.74422 WP_000999919.1.745 WP_000999919.1.7491 WP_000999919.1.74992 WP_000999919.1.75957 WP_000999919.1.76301 WP_000999919.1.76327 WP_000999919.1.76724 WP_000999919.1.77177 WP_000999919.1.77184 WP_000999919.1.77193 WP_000999919.1.77267 WP_000999919.1.77271 WP_000999919.1.77575 WP_000999919.1.77710 WP_000999919.1.77971 WP_000999919.1.78245 WP_000999919.1.78372 WP_000999919.1.78838 WP_000999919.1.78862 WP_000999919.1.7891 WP_000999919.1.79032 WP_000999919.1.79140 WP_000999919.1.79302 WP_000999919.1.79370 WP_000999919.1.79734 WP_000999919.1.79832 WP_000999919.1.79892 WP_000999919.1.79966 WP_000999919.1.80443 WP_000999919.1.80448 WP_000999919.1.80542 WP_000999919.1.80667 WP_000999919.1.80674 WP_000999919.1.80741 WP_000999919.1.80750 WP_000999919.1.81305 WP_000999919.1.81320 WP_000999919.1.81321 WP_000999919.1.81328 WP_000999919.1.81528 WP_000999919.1.81735 WP_000999919.1.81760 WP_000999919.1.81795 WP_000999919.1.81965 WP_000999919.1.82099 WP_000999919.1.82192 WP_000999919.1.82232 WP_000999919.1.82464 WP_000999919.1.82843 WP_000999919.1.83119 WP_000999919.1.83301 WP_000999919.1.83407 WP_000999919.1.83897 WP_000999919.1.83960 WP_000999919.1.84001 WP_000999919.1.84077 WP_000999919.1.84100 WP_000999919.1.84291 WP_000999919.1.84397 WP_000999919.1.84683 WP_000999919.1.85014 WP_000999919.1.85147 WP_000999919.1.85568 WP_000999919.1.86017 WP_000999919.1.86043 WP_000999919.1.86173 WP_000999919.1.86285 WP_000999919.1.86335 WP_000999919.1.86601 WP_000999919.1.86634 WP_000999919.1.8671 WP_000999919.1.87051 WP_000999919.1.87687 WP_000999919.1.87695 WP_000999919.1.87899 WP_000999919.1.8792 WP_000999919.1.88092 WP_000999919.1.88942 WP_000999919.1.88957 WP_000999919.1.88967 WP_000999919.1.88980 WP_000999919.1.89114 WP_000999919.1.89119 WP_000999919.1.89452 WP_000999919.1.89657 WP_000999919.1.89765 WP_000999919.1.89817 WP_000999919.1.89965 WP_000999919.1.90084 WP_000999919.1.90440 WP_000999919.1.9064 WP_000999919.1.90984 WP_000999919.1.91049 WP_000999919.1.91056 WP_000999919.1.91179 WP_000999919.1.91621 WP_000999919.1.92165 WP_000999919.1.92375 WP_000999919.1.92562 WP_000999919.1.92893 WP_000999919.1.92988 WP_000999919.1.93059 WP_000999919.1.93061 WP_000999919.1.93213 WP_000999919.1.93339 WP_000999919.1.93741 WP_000999919.1.93937 WP_000999919.1.93956 WP_000999919.1.94412 WP_000999919.1.94655 WP_000999919.1.95248 WP_000999919.1.95249 WP_000999919.1.95277 WP_000999919.1.9530 WP_000999919.1.95388 WP_000999919.1.95670 WP_000999919.1.95691 WP_000999919.1.95744 WP_000999919.1.95939 WP_000999919.1.96004 WP_000999919.1.96162 WP_000999919.1.96590 WP_000999919.1.9674 WP_000999919.1.96917 WP_000999919.1.97043 WP_000999919.1.97047 WP_000999919.1.97109 WP_000999919.1.97143 WP_000999919.1.97297 WP_000999919.1.97477 WP_000999919.1.97487 WP_000999919.1.97631 WP_000999919.1.9799 WP_000999919.1.98170 WP_000999919.1.9826 WP_000999919.1.98402 WP_000999919.1.98551 WP_000999919.1.98634 WP_000999919.1.98947 WP_000999919.1.99040 WP_000999919.1.99626 WP_000999919.1.99824 ABEL01000016|CDS_7891-7571 ABEW01000013|CDS_44837-45157 ABFG01000008|CDS_204939-205259 CP001120|CDS_4159241-4158921 gi|194448439|ref|YP_002047956.1| 454169.SeHA_C4270 gi|525815214|ref|YP_008245232.1| gi|386589308|ref|YP_006085708.1| gi|525828406|ref|YP_008251261.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]