SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000999920.1.66779 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000999920.1.66779
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 4.53e-40
Family Frataxin-like 0.000000825
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000999920.1.66779
Sequence length 106
Comment iron donor protein CyaY [Salmonella enterica]; AA=GCF_002034675.1; RF=na; TAX=913240; STAX=28901; NAME=Salmonella enterica subsp. enterica serovar Alachua; strain=BCW_1608; AL=Contig; RT=Major
Sequence
MNDSEFHRLADALWLTIEERLDNWDGDSDIDCEINGGVLTISFENGSKIIINRQEPLHQV
WLATKQGGYHFDLKGDEWVCDRSGETFWELLEQAATQQAGEKVSFR
Download sequence
Identical sequences WP_000999920.1.101199 WP_000999920.1.15353 WP_000999920.1.1611 WP_000999920.1.18177 WP_000999920.1.18426 WP_000999920.1.24723 WP_000999920.1.25825 WP_000999920.1.26787 WP_000999920.1.2829 WP_000999920.1.3170 WP_000999920.1.3734 WP_000999920.1.44191 WP_000999920.1.45468 WP_000999920.1.49602 WP_000999920.1.50478 WP_000999920.1.51419 WP_000999920.1.52123 WP_000999920.1.5333 WP_000999920.1.56354 WP_000999920.1.61114 WP_000999920.1.63155 WP_000999920.1.63499 WP_000999920.1.66779 WP_000999920.1.73512 WP_000999920.1.74807 WP_000999920.1.76055 WP_000999920.1.7633 WP_000999920.1.81727 WP_000999920.1.84551 WP_000999920.1.86120 WP_000999920.1.89291 WP_000999920.1.89580 WP_000999920.1.91042 WP_000999920.1.96761 WP_000999920.1.98483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]