SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000999923.1.94921 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000999923.1.94921
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 5.93e-40
Family Frataxin-like 0.000000782
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000999923.1.94921
Sequence length 106
Comment iron donor protein CyaY [Salmonella enterica]; AA=GCF_001448865.1; RF=na; TAX=1243604; STAX=28901; NAME=Salmonella enterica subsp. salamae serovar 56:z10:e,n,x str. 1369-73; strain=1369-73; AL=Contig; RT=Major
Sequence
MNDSEFHRLADALWLTIEERLDNWDGDSDIDCEINGGVLTLSFENGSKIIINRQEPLHQV
WLATKQGGYHFDLKGDEWICDRSGETFWDLLEQAATQQAGEAVSFR
Download sequence
Identical sequences A0A0F5B4H6 A0A0V2CVX7 A0A241SJF5 G5LGL3
WP_000999923.1.101223 WP_000999923.1.101740 WP_000999923.1.12517 WP_000999923.1.18688 WP_000999923.1.25607 WP_000999923.1.25692 WP_000999923.1.26199 WP_000999923.1.27142 WP_000999923.1.28514 WP_000999923.1.33343 WP_000999923.1.33786 WP_000999923.1.37119 WP_000999923.1.42394 WP_000999923.1.43782 WP_000999923.1.44208 WP_000999923.1.46124 WP_000999923.1.46975 WP_000999923.1.48342 WP_000999923.1.60918 WP_000999923.1.62442 WP_000999923.1.68999 WP_000999923.1.70644 WP_000999923.1.71658 WP_000999923.1.94921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]