SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_000999925.1.24944 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000999925.1.24944
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 6.63e-40
Family Frataxin-like 0.000000803
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000999925.1.24944
Sequence length 106
Comment iron donor protein CyaY [Salmonella enterica]; AA=GCF_002038545.1; RF=na; TAX=149539; STAX=28901; NAME=Salmonella enterica subsp. enterica serovar Enteritidis; strain=CFSAN057683; AL=Scaffold; RT=Major
Sequence
MNDSEFHRLADALWLTIEERLDNWDGDSDIDCEINGGVLTLSFENGSKIIINRQEPLHQV
WLATKQGGYHFDLKGDEWVCDRSGETFWDLLEQAATQQAGEKVSFR
Download sequence
Identical sequences A0A0G2NSX0 A0A1R2VJX7 A0A1U7FTF7 A0A1X2UJK6 A0A221YS89 A0A267SFP8 A0A2K2K0F6 B5FNU2 B5QVJ3 B5RFQ2 G5PV79 G5QAM1 M7SAV4 Q8Z3A4 S4KCJ5
209261.t3354 220341.STY3616 439851.SeD_A4329 550537.SEN3741 550538.SG3507 gi|207859146|ref|YP_002245797.1| gi|16762191|ref|NP_457808.1| ABAK02000001|CDS_3458868-3458548 ABEI01000022|CDS_9680-9360 AE014613|CDS_3455762-3456082 AL513382|CDS_3470104-3470424 AM933172|CDS_4019701-4019381 AM933173|CDS_3678924-3679244 CP001144|CDS_4177919-4177599 gi|529221224|ref|YP_008382700.1| gi|537438654|ref|YP_008483031.1| gi|378957089|ref|YP_005214576.1| gi|205354495|ref|YP_002228296.1| gi|378961532|ref|YP_005219018.1| gi|29143680|ref|NP_807022.1| gi|488655811|ref|YP_007927614.1| gi|198244470|ref|YP_002217873.1| NP_457808.1.84458 WP_000999925.1.100007 WP_000999925.1.100008 WP_000999925.1.100017 WP_000999925.1.100031 WP_000999925.1.100036 WP_000999925.1.100077 WP_000999925.1.100079 WP_000999925.1.100149 WP_000999925.1.100191 WP_000999925.1.100196 WP_000999925.1.1002 WP_000999925.1.100284 WP_000999925.1.100313 WP_000999925.1.100314 WP_000999925.1.100321 WP_000999925.1.100354 WP_000999925.1.100392 WP_000999925.1.100412 WP_000999925.1.100421 WP_000999925.1.100446 WP_000999925.1.100450 WP_000999925.1.100457 WP_000999925.1.100519 WP_000999925.1.100541 WP_000999925.1.100557 WP_000999925.1.100592 WP_000999925.1.100605 WP_000999925.1.100610 WP_000999925.1.100732 WP_000999925.1.100733 WP_000999925.1.100739 WP_000999925.1.10074 WP_000999925.1.100764 WP_000999925.1.100776 WP_000999925.1.100799 WP_000999925.1.10081 WP_000999925.1.100857 WP_000999925.1.100865 WP_000999925.1.100895 WP_000999925.1.100941 WP_000999925.1.100944 WP_000999925.1.100953 WP_000999925.1.101011 WP_000999925.1.10108 WP_000999925.1.101094 WP_000999925.1.101112 WP_000999925.1.101226 WP_000999925.1.10124 WP_000999925.1.101271 WP_000999925.1.101312 WP_000999925.1.101322 WP_000999925.1.101374 WP_000999925.1.101473 WP_000999925.1.101519 WP_000999925.1.101541 WP_000999925.1.101616 WP_000999925.1.101634 WP_000999925.1.101639 WP_000999925.1.101674 WP_000999925.1.101744 WP_000999925.1.101759 WP_000999925.1.101832 WP_000999925.1.101839 WP_000999925.1.101890 WP_000999925.1.101917 WP_000999925.1.101927 WP_000999925.1.101941 WP_000999925.1.101949 WP_000999925.1.102050 WP_000999925.1.102087 WP_000999925.1.102111 WP_000999925.1.10276 WP_000999925.1.10300 WP_000999925.1.10338 WP_000999925.1.1038 WP_000999925.1.10394 WP_000999925.1.104 WP_000999925.1.10401 WP_000999925.1.10428 WP_000999925.1.10459 WP_000999925.1.10475 WP_000999925.1.10498 WP_000999925.1.10511 WP_000999925.1.10514 WP_000999925.1.10530 WP_000999925.1.10532 WP_000999925.1.10547 WP_000999925.1.10562 WP_000999925.1.10595 WP_000999925.1.10631 WP_000999925.1.10642 WP_000999925.1.10654 WP_000999925.1.10677 WP_000999925.1.10755 WP_000999925.1.10857 WP_000999925.1.10868 WP_000999925.1.10873 WP_000999925.1.10898 WP_000999925.1.10926 WP_000999925.1.10936 WP_000999925.1.11012 WP_000999925.1.11055 WP_000999925.1.11119 WP_000999925.1.11126 WP_000999925.1.11142 WP_000999925.1.11213 WP_000999925.1.11216 WP_000999925.1.11239 WP_000999925.1.11253 WP_000999925.1.11314 WP_000999925.1.11385 WP_000999925.1.1142 WP_000999925.1.11426 WP_000999925.1.11429 WP_000999925.1.1150 WP_000999925.1.11526 WP_000999925.1.11528 WP_000999925.1.11557 WP_000999925.1.1156 WP_000999925.1.11567 WP_000999925.1.11638 WP_000999925.1.1169 WP_000999925.1.1174 WP_000999925.1.11824 WP_000999925.1.11841 WP_000999925.1.11868 WP_000999925.1.11883 WP_000999925.1.11900 WP_000999925.1.11908 WP_000999925.1.11914 WP_000999925.1.11938 WP_000999925.1.11978 WP_000999925.1.12007 WP_000999925.1.12027 WP_000999925.1.12040 WP_000999925.1.12047 WP_000999925.1.12061 WP_000999925.1.1207 WP_000999925.1.12106 WP_000999925.1.12141 WP_000999925.1.1215 WP_000999925.1.12159 WP_000999925.1.12168 WP_000999925.1.12172 WP_000999925.1.12192 WP_000999925.1.1224 WP_000999925.1.12340 WP_000999925.1.12364 WP_000999925.1.12374 WP_000999925.1.1239 WP_000999925.1.12396 WP_000999925.1.12398 WP_000999925.1.12441 WP_000999925.1.12472 WP_000999925.1.12485 WP_000999925.1.12568 WP_000999925.1.12569 WP_000999925.1.12581 WP_000999925.1.12585 WP_000999925.1.12620 WP_000999925.1.12648 WP_000999925.1.12683 WP_000999925.1.12696 WP_000999925.1.12726 WP_000999925.1.12727 WP_000999925.1.12741 WP_000999925.1.12834 WP_000999925.1.12864 WP_000999925.1.1300 WP_000999925.1.13076 WP_000999925.1.13102 WP_000999925.1.13108 WP_000999925.1.13161 WP_000999925.1.1321 WP_000999925.1.13247 WP_000999925.1.13268 WP_000999925.1.13274 WP_000999925.1.13291 WP_000999925.1.133 WP_000999925.1.13314 WP_000999925.1.13338 WP_000999925.1.13342 WP_000999925.1.13352 WP_000999925.1.13367 WP_000999925.1.13391 WP_000999925.1.13406 WP_000999925.1.13440 WP_000999925.1.13443 WP_000999925.1.1346 WP_000999925.1.13476 WP_000999925.1.13543 WP_000999925.1.13573 WP_000999925.1.13599 WP_000999925.1.13625 WP_000999925.1.13686 WP_000999925.1.1372 WP_000999925.1.13732 WP_000999925.1.13764 WP_000999925.1.1382 WP_000999925.1.13848 WP_000999925.1.13857 WP_000999925.1.1397 WP_000999925.1.13972 WP_000999925.1.140 WP_000999925.1.1401 WP_000999925.1.1408 WP_000999925.1.14089 WP_000999925.1.14099 WP_000999925.1.1412 WP_000999925.1.14120 WP_000999925.1.14123 WP_000999925.1.14150 WP_000999925.1.14191 WP_000999925.1.14197 WP_000999925.1.14280 WP_000999925.1.14333 WP_000999925.1.14369 WP_000999925.1.14399 WP_000999925.1.1440 WP_000999925.1.14444 WP_000999925.1.14467 WP_000999925.1.14474 WP_000999925.1.14495 WP_000999925.1.14500 WP_000999925.1.14526 WP_000999925.1.14550 WP_000999925.1.14575 WP_000999925.1.146 WP_000999925.1.14701 WP_000999925.1.14703 WP_000999925.1.14708 WP_000999925.1.14719 WP_000999925.1.1473 WP_000999925.1.14765 WP_000999925.1.14793 WP_000999925.1.14810 WP_000999925.1.14819 WP_000999925.1.14877 WP_000999925.1.14884 WP_000999925.1.14894 WP_000999925.1.14913 WP_000999925.1.14930 WP_000999925.1.14947 WP_000999925.1.14948 WP_000999925.1.14964 WP_000999925.1.15067 WP_000999925.1.15184 WP_000999925.1.15214 WP_000999925.1.15244 WP_000999925.1.15265 WP_000999925.1.15276 WP_000999925.1.15318 WP_000999925.1.15362 WP_000999925.1.15415 WP_000999925.1.15423 WP_000999925.1.15433 WP_000999925.1.15439 WP_000999925.1.15487 WP_000999925.1.15535 WP_000999925.1.15581 WP_000999925.1.15585 WP_000999925.1.15597 WP_000999925.1.1568 WP_000999925.1.15710 WP_000999925.1.15717 WP_000999925.1.15775 WP_000999925.1.15777 WP_000999925.1.15905 WP_000999925.1.15912 WP_000999925.1.15970 WP_000999925.1.16000 WP_000999925.1.16046 WP_000999925.1.16051 WP_000999925.1.16058 WP_000999925.1.16150 WP_000999925.1.16155 WP_000999925.1.1626 WP_000999925.1.16264 WP_000999925.1.16273 WP_000999925.1.16344 WP_000999925.1.16363 WP_000999925.1.16365 WP_000999925.1.16366 WP_000999925.1.16394 WP_000999925.1.16452 WP_000999925.1.16453 WP_000999925.1.16461 WP_000999925.1.16462 WP_000999925.1.16465 WP_000999925.1.16474 WP_000999925.1.16522 WP_000999925.1.16588 WP_000999925.1.16658 WP_000999925.1.16666 WP_000999925.1.16673 WP_000999925.1.16729 WP_000999925.1.1674 WP_000999925.1.16767 WP_000999925.1.16781 WP_000999925.1.16846 WP_000999925.1.16855 WP_000999925.1.16879 WP_000999925.1.16893 WP_000999925.1.16905 WP_000999925.1.16948 WP_000999925.1.16949 WP_000999925.1.16972 WP_000999925.1.16998 WP_000999925.1.17031 WP_000999925.1.17049 WP_000999925.1.17058 WP_000999925.1.17060 WP_000999925.1.17078 WP_000999925.1.17096 WP_000999925.1.17105 WP_000999925.1.17188 WP_000999925.1.17202 WP_000999925.1.17219 WP_000999925.1.1722 WP_000999925.1.17302 WP_000999925.1.17308 WP_000999925.1.1733 WP_000999925.1.17368 WP_000999925.1.17405 WP_000999925.1.17406 WP_000999925.1.17482 WP_000999925.1.1749 WP_000999925.1.17513 WP_000999925.1.17525 WP_000999925.1.17543 WP_000999925.1.17563 WP_000999925.1.17578 WP_000999925.1.17583 WP_000999925.1.17622 WP_000999925.1.17659 WP_000999925.1.17667 WP_000999925.1.17686 WP_000999925.1.17732 WP_000999925.1.17741 WP_000999925.1.17840 WP_000999925.1.17886 WP_000999925.1.17914 WP_000999925.1.17936 WP_000999925.1.17956 WP_000999925.1.18005 WP_000999925.1.1801 WP_000999925.1.18021 WP_000999925.1.18056 WP_000999925.1.18061 WP_000999925.1.18092 WP_000999925.1.18099 WP_000999925.1.18109 WP_000999925.1.18124 WP_000999925.1.18144 WP_000999925.1.18149 WP_000999925.1.18173 WP_000999925.1.18270 WP_000999925.1.18280 WP_000999925.1.18328 WP_000999925.1.18358 WP_000999925.1.18370 WP_000999925.1.18384 WP_000999925.1.18406 WP_000999925.1.18474 WP_000999925.1.18485 WP_000999925.1.18513 WP_000999925.1.18610 WP_000999925.1.18641 WP_000999925.1.18678 WP_000999925.1.18686 WP_000999925.1.18722 WP_000999925.1.18737 WP_000999925.1.18766 WP_000999925.1.1880 WP_000999925.1.18847 WP_000999925.1.1885 WP_000999925.1.18860 WP_000999925.1.18886 WP_000999925.1.18922 WP_000999925.1.1895 WP_000999925.1.18959 WP_000999925.1.19001 WP_000999925.1.19006 WP_000999925.1.19044 WP_000999925.1.19084 WP_000999925.1.19093 WP_000999925.1.19187 WP_000999925.1.19228 WP_000999925.1.19288 WP_000999925.1.19291 WP_000999925.1.19300 WP_000999925.1.19373 WP_000999925.1.19422 WP_000999925.1.19433 WP_000999925.1.19454 WP_000999925.1.19456 WP_000999925.1.19496 WP_000999925.1.19535 WP_000999925.1.19538 WP_000999925.1.1955 WP_000999925.1.19589 WP_000999925.1.19656 WP_000999925.1.19663 WP_000999925.1.19686 WP_000999925.1.19731 WP_000999925.1.19794 WP_000999925.1.19834 WP_000999925.1.1992 WP_000999925.1.19938 WP_000999925.1.19999 WP_000999925.1.20023 WP_000999925.1.20086 WP_000999925.1.20218 WP_000999925.1.20254 WP_000999925.1.20255 WP_000999925.1.20261 WP_000999925.1.20296 WP_000999925.1.20339 WP_000999925.1.2041 WP_000999925.1.20419 WP_000999925.1.20437 WP_000999925.1.20465 WP_000999925.1.2047 WP_000999925.1.20492 WP_000999925.1.2053 WP_000999925.1.20635 WP_000999925.1.20718 WP_000999925.1.2073 WP_000999925.1.20740 WP_000999925.1.20767 WP_000999925.1.20828 WP_000999925.1.2087 WP_000999925.1.20883 WP_000999925.1.20947 WP_000999925.1.20953 WP_000999925.1.21010 WP_000999925.1.2106 WP_000999925.1.21062 WP_000999925.1.2107 WP_000999925.1.21075 WP_000999925.1.21079 WP_000999925.1.21103 WP_000999925.1.21144 WP_000999925.1.2116 WP_000999925.1.21162 WP_000999925.1.21184 WP_000999925.1.21185 WP_000999925.1.21194 WP_000999925.1.21202 WP_000999925.1.21241 WP_000999925.1.21286 WP_000999925.1.21332 WP_000999925.1.21366 WP_000999925.1.21399 WP_000999925.1.21443 WP_000999925.1.21492 WP_000999925.1.21616 WP_000999925.1.2166 WP_000999925.1.21674 WP_000999925.1.21681 WP_000999925.1.21715 WP_000999925.1.21728 WP_000999925.1.21909 WP_000999925.1.21910 WP_000999925.1.21940 WP_000999925.1.21946 WP_000999925.1.21950 WP_000999925.1.21966 WP_000999925.1.22051 WP_000999925.1.22064 WP_000999925.1.22096 WP_000999925.1.22118 WP_000999925.1.22126 WP_000999925.1.22136 WP_000999925.1.22158 WP_000999925.1.2216 WP_000999925.1.22162 WP_000999925.1.22205 WP_000999925.1.22208 WP_000999925.1.2227 WP_000999925.1.22296 WP_000999925.1.22346 WP_000999925.1.22373 WP_000999925.1.22449 WP_000999925.1.22454 WP_000999925.1.22460 WP_000999925.1.22476 WP_000999925.1.22565 WP_000999925.1.22590 WP_000999925.1.22595 WP_000999925.1.22605 WP_000999925.1.22614 WP_000999925.1.22652 WP_000999925.1.22683 WP_000999925.1.22760 WP_000999925.1.2284 WP_000999925.1.22857 WP_000999925.1.22880 WP_000999925.1.22895 WP_000999925.1.22902 WP_000999925.1.22926 WP_000999925.1.22943 WP_000999925.1.22947 WP_000999925.1.22967 WP_000999925.1.23040 WP_000999925.1.23058 WP_000999925.1.23175 WP_000999925.1.23218 WP_000999925.1.2324 WP_000999925.1.23279 WP_000999925.1.2331 WP_000999925.1.23311 WP_000999925.1.2332 WP_000999925.1.23329 WP_000999925.1.23340 WP_000999925.1.23343 WP_000999925.1.2336 WP_000999925.1.23365 WP_000999925.1.23412 WP_000999925.1.23426 WP_000999925.1.23442 WP_000999925.1.23492 WP_000999925.1.23500 WP_000999925.1.23515 WP_000999925.1.23529 WP_000999925.1.23548 WP_000999925.1.23571 WP_000999925.1.2358 WP_000999925.1.23604 WP_000999925.1.23631 WP_000999925.1.23639 WP_000999925.1.23679 WP_000999925.1.237 WP_000999925.1.23720 WP_000999925.1.23728 WP_000999925.1.23746 WP_000999925.1.2375 WP_000999925.1.23783 WP_000999925.1.23786 WP_000999925.1.23787 WP_000999925.1.2380 WP_000999925.1.23801 WP_000999925.1.24028 WP_000999925.1.24061 WP_000999925.1.24083 WP_000999925.1.24117 WP_000999925.1.24125 WP_000999925.1.24138 WP_000999925.1.24145 WP_000999925.1.2415 WP_000999925.1.24153 WP_000999925.1.24214 WP_000999925.1.24250 WP_000999925.1.24291 WP_000999925.1.24297 WP_000999925.1.24322 WP_000999925.1.24355 WP_000999925.1.24361 WP_000999925.1.24375 WP_000999925.1.24400 WP_000999925.1.24408 WP_000999925.1.24409 WP_000999925.1.24420 WP_000999925.1.24476 WP_000999925.1.24494 WP_000999925.1.24619 WP_000999925.1.24643 WP_000999925.1.24673 WP_000999925.1.24686 WP_000999925.1.24688 WP_000999925.1.24716 WP_000999925.1.24803 WP_000999925.1.2481 WP_000999925.1.24832 WP_000999925.1.24839 WP_000999925.1.24901 WP_000999925.1.24944 WP_000999925.1.24964 WP_000999925.1.25017 WP_000999925.1.25032 WP_000999925.1.25041 WP_000999925.1.25053 WP_000999925.1.25064 WP_000999925.1.25140 WP_000999925.1.25159 WP_000999925.1.25175 WP_000999925.1.25185 WP_000999925.1.25196 WP_000999925.1.25210 WP_000999925.1.25219 WP_000999925.1.25304 WP_000999925.1.25354 WP_000999925.1.25374 WP_000999925.1.25421 WP_000999925.1.25426 WP_000999925.1.25475 WP_000999925.1.25490 WP_000999925.1.25508 WP_000999925.1.25512 WP_000999925.1.25546 WP_000999925.1.25603 WP_000999925.1.25618 WP_000999925.1.2562 WP_000999925.1.25666 WP_000999925.1.2568 WP_000999925.1.25709 WP_000999925.1.25780 WP_000999925.1.25807 WP_000999925.1.25809 WP_000999925.1.25821 WP_000999925.1.25833 WP_000999925.1.25835 WP_000999925.1.25882 WP_000999925.1.25911 WP_000999925.1.25951 WP_000999925.1.25962 WP_000999925.1.25963 WP_000999925.1.26001 WP_000999925.1.26027 WP_000999925.1.26083 WP_000999925.1.26107 WP_000999925.1.2615 WP_000999925.1.26194 WP_000999925.1.26217 WP_000999925.1.26230 WP_000999925.1.26232 WP_000999925.1.26272 WP_000999925.1.26286 WP_000999925.1.26288 WP_000999925.1.26384 WP_000999925.1.26394 WP_000999925.1.26441 WP_000999925.1.26491 WP_000999925.1.26512 WP_000999925.1.26532 WP_000999925.1.2654 WP_000999925.1.26554 WP_000999925.1.26587 WP_000999925.1.26636 WP_000999925.1.26687 WP_000999925.1.26689 WP_000999925.1.2672 WP_000999925.1.2679 WP_000999925.1.26794 WP_000999925.1.26892 WP_000999925.1.26908 WP_000999925.1.2692 WP_000999925.1.26928 WP_000999925.1.26936 WP_000999925.1.270 WP_000999925.1.27008 WP_000999925.1.27027 WP_000999925.1.27051 WP_000999925.1.27070 WP_000999925.1.27077 WP_000999925.1.27086 WP_000999925.1.27087 WP_000999925.1.27111 WP_000999925.1.27115 WP_000999925.1.2713 WP_000999925.1.2717 WP_000999925.1.27228 WP_000999925.1.27272 WP_000999925.1.27282 WP_000999925.1.27285 WP_000999925.1.27309 WP_000999925.1.27314 WP_000999925.1.27329 WP_000999925.1.27361 WP_000999925.1.27383 WP_000999925.1.27535 WP_000999925.1.27547 WP_000999925.1.27565 WP_000999925.1.27595 WP_000999925.1.27598 WP_000999925.1.27632 WP_000999925.1.27638 WP_000999925.1.27658 WP_000999925.1.27706 WP_000999925.1.27775 WP_000999925.1.27785 WP_000999925.1.27798 WP_000999925.1.27800 WP_000999925.1.27833 WP_000999925.1.27883 WP_000999925.1.27900 WP_000999925.1.27928 WP_000999925.1.27945 WP_000999925.1.27969 WP_000999925.1.27995 WP_000999925.1.28004 WP_000999925.1.28037 WP_000999925.1.28056 WP_000999925.1.28073 WP_000999925.1.2809 WP_000999925.1.28139 WP_000999925.1.28155 WP_000999925.1.28198 WP_000999925.1.28200 WP_000999925.1.2822 WP_000999925.1.28229 WP_000999925.1.28232 WP_000999925.1.28233 WP_000999925.1.28267 WP_000999925.1.28303 WP_000999925.1.28384 WP_000999925.1.28386 WP_000999925.1.28395 WP_000999925.1.284 WP_000999925.1.2845 WP_000999925.1.28462 WP_000999925.1.28479 WP_000999925.1.2853 WP_000999925.1.28570 WP_000999925.1.28620 WP_000999925.1.28627 WP_000999925.1.28673 WP_000999925.1.28692 WP_000999925.1.2873 WP_000999925.1.28733 WP_000999925.1.28773 WP_000999925.1.28917 WP_000999925.1.28962 WP_000999925.1.29023 WP_000999925.1.29042 WP_000999925.1.2905 WP_000999925.1.2907 WP_000999925.1.29081 WP_000999925.1.29089 WP_000999925.1.29153 WP_000999925.1.29168 WP_000999925.1.29203 WP_000999925.1.29218 WP_000999925.1.29237 WP_000999925.1.2924 WP_000999925.1.29248 WP_000999925.1.29274 WP_000999925.1.29288 WP_000999925.1.2932 WP_000999925.1.29379 WP_000999925.1.29389 WP_000999925.1.29422 WP_000999925.1.29436 WP_000999925.1.29439 WP_000999925.1.2946 WP_000999925.1.29462 WP_000999925.1.29563 WP_000999925.1.29576 WP_000999925.1.29711 WP_000999925.1.29727 WP_000999925.1.29743 WP_000999925.1.29782 WP_000999925.1.29851 WP_000999925.1.29865 WP_000999925.1.29886 WP_000999925.1.29919 WP_000999925.1.2994 WP_000999925.1.29964 WP_000999925.1.29983 WP_000999925.1.30009 WP_000999925.1.30013 WP_000999925.1.3002 WP_000999925.1.30034 WP_000999925.1.30049 WP_000999925.1.3005 WP_000999925.1.30058 WP_000999925.1.30059 WP_000999925.1.30165 WP_000999925.1.30170 WP_000999925.1.30172 WP_000999925.1.30185 WP_000999925.1.30195 WP_000999925.1.30210 WP_000999925.1.30213 WP_000999925.1.30278 WP_000999925.1.30354 WP_000999925.1.30357 WP_000999925.1.30362 WP_000999925.1.3042 WP_000999925.1.30421 WP_000999925.1.30425 WP_000999925.1.30440 WP_000999925.1.30448 WP_000999925.1.30489 WP_000999925.1.30492 WP_000999925.1.30517 WP_000999925.1.30542 WP_000999925.1.30544 WP_000999925.1.30548 WP_000999925.1.30556 WP_000999925.1.30572 WP_000999925.1.30585 WP_000999925.1.30589 WP_000999925.1.30618 WP_000999925.1.30627 WP_000999925.1.30664 WP_000999925.1.3067 WP_000999925.1.30688 WP_000999925.1.30752 WP_000999925.1.30806 WP_000999925.1.30819 WP_000999925.1.30823 WP_000999925.1.3089 WP_000999925.1.30967 WP_000999925.1.30968 WP_000999925.1.31001 WP_000999925.1.31011 WP_000999925.1.31046 WP_000999925.1.31066 WP_000999925.1.31078 WP_000999925.1.31086 WP_000999925.1.31139 WP_000999925.1.31145 WP_000999925.1.31167 WP_000999925.1.31182 WP_000999925.1.31198 WP_000999925.1.31205 WP_000999925.1.3121 WP_000999925.1.31223 WP_000999925.1.31272 WP_000999925.1.31303 WP_000999925.1.3131 WP_000999925.1.31335 WP_000999925.1.31352 WP_000999925.1.31389 WP_000999925.1.31413 WP_000999925.1.31435 WP_000999925.1.31446 WP_000999925.1.31533 WP_000999925.1.31585 WP_000999925.1.3167 WP_000999925.1.31799 WP_000999925.1.31836 WP_000999925.1.31895 WP_000999925.1.31901 WP_000999925.1.31951 WP_000999925.1.31983 WP_000999925.1.32006 WP_000999925.1.32041 WP_000999925.1.32042 WP_000999925.1.32056 WP_000999925.1.3207 WP_000999925.1.32109 WP_000999925.1.32116 WP_000999925.1.32170 WP_000999925.1.32189 WP_000999925.1.32202 WP_000999925.1.32252 WP_000999925.1.32255 WP_000999925.1.32263 WP_000999925.1.32274 WP_000999925.1.32293 WP_000999925.1.32299 WP_000999925.1.32309 WP_000999925.1.32368 WP_000999925.1.32422 WP_000999925.1.32425 WP_000999925.1.32458 WP_000999925.1.32460 WP_000999925.1.32519 WP_000999925.1.32529 WP_000999925.1.32545 WP_000999925.1.32563 WP_000999925.1.32578 WP_000999925.1.32617 WP_000999925.1.32624 WP_000999925.1.32668 WP_000999925.1.3270 WP_000999925.1.32725 WP_000999925.1.32740 WP_000999925.1.32832 WP_000999925.1.32838 WP_000999925.1.32848 WP_000999925.1.32868 WP_000999925.1.32881 WP_000999925.1.32899 WP_000999925.1.3290 WP_000999925.1.32930 WP_000999925.1.32940 WP_000999925.1.32941 WP_000999925.1.3296 WP_000999925.1.32966 WP_000999925.1.32977 WP_000999925.1.32985 WP_000999925.1.33037 WP_000999925.1.3305 WP_000999925.1.33051 WP_000999925.1.33065 WP_000999925.1.33122 WP_000999925.1.3315 WP_000999925.1.33208 WP_000999925.1.33214 WP_000999925.1.33247 WP_000999925.1.33253 WP_000999925.1.33270 WP_000999925.1.33280 WP_000999925.1.33283 WP_000999925.1.33313 WP_000999925.1.33339 WP_000999925.1.33382 WP_000999925.1.33409 WP_000999925.1.33486 WP_000999925.1.33490 WP_000999925.1.335 WP_000999925.1.33501 WP_000999925.1.33529 WP_000999925.1.3356 WP_000999925.1.33586 WP_000999925.1.3364 WP_000999925.1.33659 WP_000999925.1.33689 WP_000999925.1.33693 WP_000999925.1.3370 WP_000999925.1.33730 WP_000999925.1.33741 WP_000999925.1.33840 WP_000999925.1.33865 WP_000999925.1.3392 WP_000999925.1.33926 WP_000999925.1.33957 WP_000999925.1.3396 WP_000999925.1.33969 WP_000999925.1.34 WP_000999925.1.34001 WP_000999925.1.34059 WP_000999925.1.34081 WP_000999925.1.34091 WP_000999925.1.34118 WP_000999925.1.34185 WP_000999925.1.34211 WP_000999925.1.34214 WP_000999925.1.34234 WP_000999925.1.34284 WP_000999925.1.34292 WP_000999925.1.34304 WP_000999925.1.34376 WP_000999925.1.3438 WP_000999925.1.34382 WP_000999925.1.34431 WP_000999925.1.34454 WP_000999925.1.34484 WP_000999925.1.34517 WP_000999925.1.34530 WP_000999925.1.34614 WP_000999925.1.34659 WP_000999925.1.34665 WP_000999925.1.34684 WP_000999925.1.34694 WP_000999925.1.34703 WP_000999925.1.34707 WP_000999925.1.34711 WP_000999925.1.34751 WP_000999925.1.34801 WP_000999925.1.34808 WP_000999925.1.34820 WP_000999925.1.34824 WP_000999925.1.34834 WP_000999925.1.34932 WP_000999925.1.34962 WP_000999925.1.35001 WP_000999925.1.35040 WP_000999925.1.35074 WP_000999925.1.35219 WP_000999925.1.35240 WP_000999925.1.35274 WP_000999925.1.35298 WP_000999925.1.35321 WP_000999925.1.35332 WP_000999925.1.35494 WP_000999925.1.35532 WP_000999925.1.35560 WP_000999925.1.35563 WP_000999925.1.3557 WP_000999925.1.35570 WP_000999925.1.35594 WP_000999925.1.35619 WP_000999925.1.35624 WP_000999925.1.35628 WP_000999925.1.3570 WP_000999925.1.35712 WP_000999925.1.35713 WP_000999925.1.3572 WP_000999925.1.35736 WP_000999925.1.35791 WP_000999925.1.35795 WP_000999925.1.35868 WP_000999925.1.35870 WP_000999925.1.35887 WP_000999925.1.35916 WP_000999925.1.35936 WP_000999925.1.35938 WP_000999925.1.35961 WP_000999925.1.35966 WP_000999925.1.36000 WP_000999925.1.36034 WP_000999925.1.36036 WP_000999925.1.36037 WP_000999925.1.36063 WP_000999925.1.36069 WP_000999925.1.36286 WP_000999925.1.36291 WP_000999925.1.36298 WP_000999925.1.36308 WP_000999925.1.36323 WP_000999925.1.36343 WP_000999925.1.36409 WP_000999925.1.36445 WP_000999925.1.36460 WP_000999925.1.3649 WP_000999925.1.36495 WP_000999925.1.36512 WP_000999925.1.36526 WP_000999925.1.36567 WP_000999925.1.36579 WP_000999925.1.36584 WP_000999925.1.36617 WP_000999925.1.36618 WP_000999925.1.36643 WP_000999925.1.36663 WP_000999925.1.36685 WP_000999925.1.36701 WP_000999925.1.36721 WP_000999925.1.36725 WP_000999925.1.36764 WP_000999925.1.36779 WP_000999925.1.36798 WP_000999925.1.36802 WP_000999925.1.36821 WP_000999925.1.36839 WP_000999925.1.36853 WP_000999925.1.36889 WP_000999925.1.36950 WP_000999925.1.37014 WP_000999925.1.37029 WP_000999925.1.37114 WP_000999925.1.37133 WP_000999925.1.37176 WP_000999925.1.37191 WP_000999925.1.37199 WP_000999925.1.37200 WP_000999925.1.37258 WP_000999925.1.3726 WP_000999925.1.37267 WP_000999925.1.37297 WP_000999925.1.37303 WP_000999925.1.37351 WP_000999925.1.37405 WP_000999925.1.3748 WP_000999925.1.3751 WP_000999925.1.37513 WP_000999925.1.37584 WP_000999925.1.37590 WP_000999925.1.37593 WP_000999925.1.37600 WP_000999925.1.37610 WP_000999925.1.37613 WP_000999925.1.37659 WP_000999925.1.37662 WP_000999925.1.37675 WP_000999925.1.37691 WP_000999925.1.3771 WP_000999925.1.37761 WP_000999925.1.37775 WP_000999925.1.37777 WP_000999925.1.3778 WP_000999925.1.378 WP_000999925.1.37864 WP_000999925.1.379 WP_000999925.1.3790 WP_000999925.1.37911 WP_000999925.1.37941 WP_000999925.1.37965 WP_000999925.1.37985 WP_000999925.1.38037 WP_000999925.1.38047 WP_000999925.1.38061 WP_000999925.1.38064 WP_000999925.1.38108 WP_000999925.1.3816 WP_000999925.1.38207 WP_000999925.1.38261 WP_000999925.1.38266 WP_000999925.1.38322 WP_000999925.1.3834 WP_000999925.1.38344 WP_000999925.1.38349 WP_000999925.1.38351 WP_000999925.1.3838 WP_000999925.1.38381 WP_000999925.1.38440 WP_000999925.1.38486 WP_000999925.1.38512 WP_000999925.1.38515 WP_000999925.1.38595 WP_000999925.1.3860 WP_000999925.1.38622 WP_000999925.1.38642 WP_000999925.1.38734 WP_000999925.1.38830 WP_000999925.1.38877 WP_000999925.1.38983 WP_000999925.1.38996 WP_000999925.1.39048 WP_000999925.1.39055 WP_000999925.1.39056 WP_000999925.1.39065 WP_000999925.1.3907 WP_000999925.1.39105 WP_000999925.1.39128 WP_000999925.1.3914 WP_000999925.1.39147 WP_000999925.1.39161 WP_000999925.1.39210 WP_000999925.1.39235 WP_000999925.1.39275 WP_000999925.1.3931 WP_000999925.1.39312 WP_000999925.1.39395 WP_000999925.1.39414 WP_000999925.1.39435 WP_000999925.1.39502 WP_000999925.1.39503 WP_000999925.1.39530 WP_000999925.1.39614 WP_000999925.1.39619 WP_000999925.1.39620 WP_000999925.1.39624 WP_000999925.1.39659 WP_000999925.1.39667 WP_000999925.1.39775 WP_000999925.1.39808 WP_000999925.1.39879 WP_000999925.1.39890 WP_000999925.1.39941 WP_000999925.1.39945 WP_000999925.1.39947 WP_000999925.1.40025 WP_000999925.1.40081 WP_000999925.1.40095 WP_000999925.1.40097 WP_000999925.1.401 WP_000999925.1.40158 WP_000999925.1.40160 WP_000999925.1.40167 WP_000999925.1.40279 WP_000999925.1.40284 WP_000999925.1.40307 WP_000999925.1.40361 WP_000999925.1.4042 WP_000999925.1.40467 WP_000999925.1.40493 WP_000999925.1.40496 WP_000999925.1.40517 WP_000999925.1.40533 WP_000999925.1.40577 WP_000999925.1.40622 WP_000999925.1.40695 WP_000999925.1.40698 WP_000999925.1.40722 WP_000999925.1.40745 WP_000999925.1.40750 WP_000999925.1.40763 WP_000999925.1.40849 WP_000999925.1.40854 WP_000999925.1.4089 WP_000999925.1.40924 WP_000999925.1.40930 WP_000999925.1.40932 WP_000999925.1.40946 WP_000999925.1.40973 WP_000999925.1.41004 WP_000999925.1.4106 WP_000999925.1.41070 WP_000999925.1.41074 WP_000999925.1.41075 WP_000999925.1.41097 WP_000999925.1.41116 WP_000999925.1.41128 WP_000999925.1.41132 WP_000999925.1.41176 WP_000999925.1.41192 WP_000999925.1.41251 WP_000999925.1.41258 WP_000999925.1.41277 WP_000999925.1.41299 WP_000999925.1.41305 WP_000999925.1.41321 WP_000999925.1.41333 WP_000999925.1.41335 WP_000999925.1.4136 WP_000999925.1.4141 WP_000999925.1.41415 WP_000999925.1.41427 WP_000999925.1.41434 WP_000999925.1.41459 WP_000999925.1.41498 WP_000999925.1.41519 WP_000999925.1.41524 WP_000999925.1.41528 WP_000999925.1.41610 WP_000999925.1.41631 WP_000999925.1.41658 WP_000999925.1.41659 WP_000999925.1.41688 WP_000999925.1.41690 WP_000999925.1.41716 WP_000999925.1.41746 WP_000999925.1.41799 WP_000999925.1.41802 WP_000999925.1.41824 WP_000999925.1.41825 WP_000999925.1.41836 WP_000999925.1.41862 WP_000999925.1.41894 WP_000999925.1.41904 WP_000999925.1.41911 WP_000999925.1.41919 WP_000999925.1.41929 WP_000999925.1.41931 WP_000999925.1.41938 WP_000999925.1.4194 WP_000999925.1.41949 WP_000999925.1.41978 WP_000999925.1.42069 WP_000999925.1.42081 WP_000999925.1.42090 WP_000999925.1.42109 WP_000999925.1.42111 WP_000999925.1.42136 WP_000999925.1.42187 WP_000999925.1.422 WP_000999925.1.42200 WP_000999925.1.42219 WP_000999925.1.42244 WP_000999925.1.42257 WP_000999925.1.42261 WP_000999925.1.42262 WP_000999925.1.42263 WP_000999925.1.42322 WP_000999925.1.42349 WP_000999925.1.42364 WP_000999925.1.42371 WP_000999925.1.42379 WP_000999925.1.42391 WP_000999925.1.42392 WP_000999925.1.42399 WP_000999925.1.42433 WP_000999925.1.42539 WP_000999925.1.4257 WP_000999925.1.42595 WP_000999925.1.42603 WP_000999925.1.42650 WP_000999925.1.42655 WP_000999925.1.42666 WP_000999925.1.4267 WP_000999925.1.42675 WP_000999925.1.42683 WP_000999925.1.42701 WP_000999925.1.42734 WP_000999925.1.42794 WP_000999925.1.42805 WP_000999925.1.42815 WP_000999925.1.42859 WP_000999925.1.42892 WP_000999925.1.42932 WP_000999925.1.4298 WP_000999925.1.42981 WP_000999925.1.43008 WP_000999925.1.43016 WP_000999925.1.43019 WP_000999925.1.43065 WP_000999925.1.43068 WP_000999925.1.43069 WP_000999925.1.43070 WP_000999925.1.43128 WP_000999925.1.43141 WP_000999925.1.43157 WP_000999925.1.43161 WP_000999925.1.43190 WP_000999925.1.43198 WP_000999925.1.43201 WP_000999925.1.4326 WP_000999925.1.43290 WP_000999925.1.43292 WP_000999925.1.43307 WP_000999925.1.4344 WP_000999925.1.43513 WP_000999925.1.43520 WP_000999925.1.43633 WP_000999925.1.43637 WP_000999925.1.43651 WP_000999925.1.43685 WP_000999925.1.43711 WP_000999925.1.43722 WP_000999925.1.43785 WP_000999925.1.43801 WP_000999925.1.43812 WP_000999925.1.43839 WP_000999925.1.43878 WP_000999925.1.43888 WP_000999925.1.43919 WP_000999925.1.43954 WP_000999925.1.43974 WP_000999925.1.44010 WP_000999925.1.44049 WP_000999925.1.44101 WP_000999925.1.44132 WP_000999925.1.44160 WP_000999925.1.44180 WP_000999925.1.44187 WP_000999925.1.44196 WP_000999925.1.44248 WP_000999925.1.44262 WP_000999925.1.44268 WP_000999925.1.4427 WP_000999925.1.44296 WP_000999925.1.44337 WP_000999925.1.44343 WP_000999925.1.44351 WP_000999925.1.44360 WP_000999925.1.44397 WP_000999925.1.44416 WP_000999925.1.44431 WP_000999925.1.44437 WP_000999925.1.44474 WP_000999925.1.44546 WP_000999925.1.4468 WP_000999925.1.44705 WP_000999925.1.44762 WP_000999925.1.44815 WP_000999925.1.44828 WP_000999925.1.44831 WP_000999925.1.44879 WP_000999925.1.44917 WP_000999925.1.44966 WP_000999925.1.44978 WP_000999925.1.44997 WP_000999925.1.44998 WP_000999925.1.4500 WP_000999925.1.4501 WP_000999925.1.45072 WP_000999925.1.45093 WP_000999925.1.45123 WP_000999925.1.45136 WP_000999925.1.45173 WP_000999925.1.45229 WP_000999925.1.45241 WP_000999925.1.45302 WP_000999925.1.4531 WP_000999925.1.45322 WP_000999925.1.45432 WP_000999925.1.45435 WP_000999925.1.45462 WP_000999925.1.45523 WP_000999925.1.45549 WP_000999925.1.45569 WP_000999925.1.45571 WP_000999925.1.45583 WP_000999925.1.45596 WP_000999925.1.45648 WP_000999925.1.45706 WP_000999925.1.45829 WP_000999925.1.45844 WP_000999925.1.45871 WP_000999925.1.45906 WP_000999925.1.45918 WP_000999925.1.4592 WP_000999925.1.46030 WP_000999925.1.46077 WP_000999925.1.46169 WP_000999925.1.46215 WP_000999925.1.46225 WP_000999925.1.46241 WP_000999925.1.46299 WP_000999925.1.46307 WP_000999925.1.46355 WP_000999925.1.464 WP_000999925.1.46454 WP_000999925.1.46461 WP_000999925.1.46504 WP_000999925.1.46505 WP_000999925.1.46551 WP_000999925.1.46559 WP_000999925.1.46578 WP_000999925.1.46701 WP_000999925.1.46726 WP_000999925.1.4674 WP_000999925.1.46781 WP_000999925.1.46816 WP_000999925.1.46842 WP_000999925.1.4686 WP_000999925.1.4690 WP_000999925.1.46920 WP_000999925.1.46945 WP_000999925.1.46967 WP_000999925.1.46976 WP_000999925.1.47036 WP_000999925.1.47037 WP_000999925.1.47042 WP_000999925.1.47059 WP_000999925.1.47085 WP_000999925.1.47123 WP_000999925.1.47215 WP_000999925.1.47245 WP_000999925.1.47507 WP_000999925.1.47523 WP_000999925.1.47531 WP_000999925.1.47532 WP_000999925.1.47567 WP_000999925.1.47576 WP_000999925.1.4758 WP_000999925.1.47605 WP_000999925.1.47630 WP_000999925.1.4774 WP_000999925.1.47756 WP_000999925.1.4781 WP_000999925.1.47829 WP_000999925.1.47850 WP_000999925.1.47875 WP_000999925.1.47886 WP_000999925.1.47898 WP_000999925.1.47911 WP_000999925.1.4795 WP_000999925.1.47988 WP_000999925.1.48019 WP_000999925.1.48100 WP_000999925.1.48114 WP_000999925.1.48139 WP_000999925.1.48190 WP_000999925.1.48215 WP_000999925.1.48218 WP_000999925.1.48247 WP_000999925.1.48268 WP_000999925.1.48292 WP_000999925.1.48324 WP_000999925.1.4839 WP_000999925.1.48426 WP_000999925.1.48430 WP_000999925.1.48436 WP_000999925.1.48524 WP_000999925.1.48586 WP_000999925.1.4859 WP_000999925.1.48591 WP_000999925.1.48610 WP_000999925.1.48631 WP_000999925.1.48663 WP_000999925.1.48690 WP_000999925.1.48734 WP_000999925.1.48756 WP_000999925.1.48778 WP_000999925.1.48797 WP_000999925.1.48849 WP_000999925.1.48918 WP_000999925.1.48931 WP_000999925.1.48955 WP_000999925.1.48963 WP_000999925.1.48973 WP_000999925.1.49004 WP_000999925.1.49106 WP_000999925.1.49117 WP_000999925.1.49121 WP_000999925.1.4914 WP_000999925.1.49140 WP_000999925.1.49153 WP_000999925.1.49166 WP_000999925.1.49262 WP_000999925.1.49311 WP_000999925.1.49334 WP_000999925.1.49355 WP_000999925.1.49429 WP_000999925.1.49434 WP_000999925.1.49450 WP_000999925.1.495 WP_000999925.1.49545 WP_000999925.1.49703 WP_000999925.1.49769 WP_000999925.1.49770 WP_000999925.1.49780 WP_000999925.1.49846 WP_000999925.1.49848 WP_000999925.1.4991 WP_000999925.1.49947 WP_000999925.1.49959 WP_000999925.1.49997 WP_000999925.1.50 WP_000999925.1.50014 WP_000999925.1.50030 WP_000999925.1.50043 WP_000999925.1.50103 WP_000999925.1.50128 WP_000999925.1.50158 WP_000999925.1.50198 WP_000999925.1.50247 WP_000999925.1.50308 WP_000999925.1.50309 WP_000999925.1.50332 WP_000999925.1.50386 WP_000999925.1.50387 WP_000999925.1.50406 WP_000999925.1.50449 WP_000999925.1.50468 WP_000999925.1.5051 WP_000999925.1.50566 WP_000999925.1.50570 WP_000999925.1.50626 WP_000999925.1.50652 WP_000999925.1.50684 WP_000999925.1.50726 WP_000999925.1.50771 WP_000999925.1.50875 WP_000999925.1.50882 WP_000999925.1.50885 WP_000999925.1.509 WP_000999925.1.50905 WP_000999925.1.50929 WP_000999925.1.50960 WP_000999925.1.50970 WP_000999925.1.51040 WP_000999925.1.51048 WP_000999925.1.51100 WP_000999925.1.51134 WP_000999925.1.51139 WP_000999925.1.51227 WP_000999925.1.5127 WP_000999925.1.51305 WP_000999925.1.51315 WP_000999925.1.51356 WP_000999925.1.5136 WP_000999925.1.51412 WP_000999925.1.51451 WP_000999925.1.51474 WP_000999925.1.51502 WP_000999925.1.51506 WP_000999925.1.51518 WP_000999925.1.51519 WP_000999925.1.51598 WP_000999925.1.51642 WP_000999925.1.51644 WP_000999925.1.51724 WP_000999925.1.51734 WP_000999925.1.51764 WP_000999925.1.51810 WP_000999925.1.51838 WP_000999925.1.51863 WP_000999925.1.51868 WP_000999925.1.51888 WP_000999925.1.51914 WP_000999925.1.51930 WP_000999925.1.51935 WP_000999925.1.51994 WP_000999925.1.520 WP_000999925.1.52057 WP_000999925.1.5211 WP_000999925.1.52114 WP_000999925.1.52129 WP_000999925.1.52191 WP_000999925.1.52202 WP_000999925.1.52209 WP_000999925.1.52301 WP_000999925.1.52321 WP_000999925.1.52339 WP_000999925.1.52469 WP_000999925.1.52571 WP_000999925.1.52582 WP_000999925.1.52586 WP_000999925.1.526 WP_000999925.1.52647 WP_000999925.1.52742 WP_000999925.1.52773 WP_000999925.1.52795 WP_000999925.1.52807 WP_000999925.1.52833 WP_000999925.1.52887 WP_000999925.1.52924 WP_000999925.1.53016 WP_000999925.1.53092 WP_000999925.1.53107 WP_000999925.1.53119 WP_000999925.1.5313 WP_000999925.1.53141 WP_000999925.1.53151 WP_000999925.1.53154 WP_000999925.1.53159 WP_000999925.1.53198 WP_000999925.1.53203 WP_000999925.1.53210 WP_000999925.1.53233 WP_000999925.1.53234 WP_000999925.1.53307 WP_000999925.1.53316 WP_000999925.1.53321 WP_000999925.1.53362 WP_000999925.1.53368 WP_000999925.1.53375 WP_000999925.1.53385 WP_000999925.1.53450 WP_000999925.1.5349 WP_000999925.1.53540 WP_000999925.1.53555 WP_000999925.1.53559 WP_000999925.1.5356 WP_000999925.1.53567 WP_000999925.1.53571 WP_000999925.1.5358 WP_000999925.1.53664 WP_000999925.1.53692 WP_000999925.1.53723 WP_000999925.1.5374 WP_000999925.1.53750 WP_000999925.1.53778 WP_000999925.1.53781 WP_000999925.1.53800 WP_000999925.1.53815 WP_000999925.1.53839 WP_000999925.1.53892 WP_000999925.1.53896 WP_000999925.1.53898 WP_000999925.1.53902 WP_000999925.1.53958 WP_000999925.1.53961 WP_000999925.1.53981 WP_000999925.1.53984 WP_000999925.1.54068 WP_000999925.1.54132 WP_000999925.1.54170 WP_000999925.1.54175 WP_000999925.1.54203 WP_000999925.1.54259 WP_000999925.1.54283 WP_000999925.1.5430 WP_000999925.1.54366 WP_000999925.1.54371 WP_000999925.1.54431 WP_000999925.1.54442 WP_000999925.1.54469 WP_000999925.1.54482 WP_000999925.1.54558 WP_000999925.1.54589 WP_000999925.1.54615 WP_000999925.1.54667 WP_000999925.1.54678 WP_000999925.1.54681 WP_000999925.1.54748 WP_000999925.1.5481 WP_000999925.1.54833 WP_000999925.1.54865 WP_000999925.1.54877 WP_000999925.1.54935 WP_000999925.1.54936 WP_000999925.1.54979 WP_000999925.1.54984 WP_000999925.1.55010 WP_000999925.1.55034 WP_000999925.1.55163 WP_000999925.1.55165 WP_000999925.1.55215 WP_000999925.1.55224 WP_000999925.1.55290 WP_000999925.1.55310 WP_000999925.1.55317 WP_000999925.1.55379 WP_000999925.1.5539 WP_000999925.1.55461 WP_000999925.1.55468 WP_000999925.1.55506 WP_000999925.1.55559 WP_000999925.1.55604 WP_000999925.1.55639 WP_000999925.1.55640 WP_000999925.1.55672 WP_000999925.1.55699 WP_000999925.1.5572 WP_000999925.1.55725 WP_000999925.1.5577 WP_000999925.1.55780 WP_000999925.1.55853 WP_000999925.1.55923 WP_000999925.1.55948 WP_000999925.1.55967 WP_000999925.1.56144 WP_000999925.1.56172 WP_000999925.1.5621 WP_000999925.1.56226 WP_000999925.1.56235 WP_000999925.1.56263 WP_000999925.1.56311 WP_000999925.1.56385 WP_000999925.1.56419 WP_000999925.1.56423 WP_000999925.1.56514 WP_000999925.1.56535 WP_000999925.1.56585 WP_000999925.1.56640 WP_000999925.1.5668 WP_000999925.1.56724 WP_000999925.1.56825 WP_000999925.1.56851 WP_000999925.1.56861 WP_000999925.1.56887 WP_000999925.1.56889 WP_000999925.1.56898 WP_000999925.1.56950 WP_000999925.1.56981 WP_000999925.1.57026 WP_000999925.1.57039 WP_000999925.1.57056 WP_000999925.1.57101 WP_000999925.1.5711 WP_000999925.1.57137 WP_000999925.1.57143 WP_000999925.1.57147 WP_000999925.1.57179 WP_000999925.1.57186 WP_000999925.1.57246 WP_000999925.1.57342 WP_000999925.1.57362 WP_000999925.1.57494 WP_000999925.1.57559 WP_000999925.1.57631 WP_000999925.1.57684 WP_000999925.1.57699 WP_000999925.1.57709 WP_000999925.1.57785 WP_000999925.1.57800 WP_000999925.1.5781 WP_000999925.1.57835 WP_000999925.1.57873 WP_000999925.1.57893 WP_000999925.1.57965 WP_000999925.1.57972 WP_000999925.1.58008 WP_000999925.1.58044 WP_000999925.1.58081 WP_000999925.1.5809 WP_000999925.1.58090 WP_000999925.1.58132 WP_000999925.1.58153 WP_000999925.1.58173 WP_000999925.1.58191 WP_000999925.1.58194 WP_000999925.1.58252 WP_000999925.1.58261 WP_000999925.1.58274 WP_000999925.1.5828 WP_000999925.1.58282 WP_000999925.1.58290 WP_000999925.1.58324 WP_000999925.1.58326 WP_000999925.1.5836 WP_000999925.1.58443 WP_000999925.1.5846 WP_000999925.1.58485 WP_000999925.1.58486 WP_000999925.1.58489 WP_000999925.1.58537 WP_000999925.1.58568 WP_000999925.1.58583 WP_000999925.1.58652 WP_000999925.1.58663 WP_000999925.1.58675 WP_000999925.1.587 WP_000999925.1.58724 WP_000999925.1.58729 WP_000999925.1.58749 WP_000999925.1.5875 WP_000999925.1.58796 WP_000999925.1.58807 WP_000999925.1.58847 WP_000999925.1.58883 WP_000999925.1.58884 WP_000999925.1.58898 WP_000999925.1.58926 WP_000999925.1.58949 WP_000999925.1.58963 WP_000999925.1.58970 WP_000999925.1.58974 WP_000999925.1.59020 WP_000999925.1.59043 WP_000999925.1.59056 WP_000999925.1.59061 WP_000999925.1.59064 WP_000999925.1.59142 WP_000999925.1.59163 WP_000999925.1.59282 WP_000999925.1.59299 WP_000999925.1.59313 WP_000999925.1.59335 WP_000999925.1.59412 WP_000999925.1.59427 WP_000999925.1.5949 WP_000999925.1.59501 WP_000999925.1.59510 WP_000999925.1.59538 WP_000999925.1.59548 WP_000999925.1.59636 WP_000999925.1.59646 WP_000999925.1.59648 WP_000999925.1.5969 WP_000999925.1.59751 WP_000999925.1.59827 WP_000999925.1.59829 WP_000999925.1.59847 WP_000999925.1.59848 WP_000999925.1.59863 WP_000999925.1.5993 WP_000999925.1.59969 WP_000999925.1.59994 WP_000999925.1.60045 WP_000999925.1.60076 WP_000999925.1.60114 WP_000999925.1.60126 WP_000999925.1.60137 WP_000999925.1.60154 WP_000999925.1.60168 WP_000999925.1.60192 WP_000999925.1.60199 WP_000999925.1.60212 WP_000999925.1.60231 WP_000999925.1.60253 WP_000999925.1.60320 WP_000999925.1.60322 WP_000999925.1.60324 WP_000999925.1.6033 WP_000999925.1.60330 WP_000999925.1.60356 WP_000999925.1.6038 WP_000999925.1.60380 WP_000999925.1.6041 WP_000999925.1.60424 WP_000999925.1.60425 WP_000999925.1.60481 WP_000999925.1.605 WP_000999925.1.60560 WP_000999925.1.6058 WP_000999925.1.60584 WP_000999925.1.6060 WP_000999925.1.60661 WP_000999925.1.60676 WP_000999925.1.60708 WP_000999925.1.60713 WP_000999925.1.60725 WP_000999925.1.60783 WP_000999925.1.60792 WP_000999925.1.608 WP_000999925.1.60807 WP_000999925.1.6086 WP_000999925.1.60866 WP_000999925.1.60882 WP_000999925.1.60889 WP_000999925.1.60897 WP_000999925.1.60950 WP_000999925.1.60976 WP_000999925.1.60990 WP_000999925.1.6104 WP_000999925.1.61044 WP_000999925.1.61076 WP_000999925.1.61123 WP_000999925.1.61147 WP_000999925.1.61168 WP_000999925.1.61184 WP_000999925.1.61210 WP_000999925.1.61356 WP_000999925.1.61357 WP_000999925.1.61381 WP_000999925.1.61501 WP_000999925.1.61511 WP_000999925.1.61539 WP_000999925.1.61542 WP_000999925.1.61553 WP_000999925.1.61582 WP_000999925.1.61594 WP_000999925.1.61595 WP_000999925.1.61649 WP_000999925.1.61652 WP_000999925.1.61671 WP_000999925.1.61697 WP_000999925.1.61743 WP_000999925.1.61809 WP_000999925.1.61877 WP_000999925.1.6190 WP_000999925.1.61908 WP_000999925.1.61920 WP_000999925.1.61968 WP_000999925.1.62120 WP_000999925.1.62122 WP_000999925.1.62124 WP_000999925.1.62158 WP_000999925.1.62199 WP_000999925.1.62201 WP_000999925.1.62210 WP_000999925.1.62223 WP_000999925.1.62245 WP_000999925.1.62302 WP_000999925.1.62314 WP_000999925.1.62333 WP_000999925.1.62338 WP_000999925.1.62344 WP_000999925.1.62380 WP_000999925.1.62411 WP_000999925.1.62412 WP_000999925.1.62436 WP_000999925.1.62475 WP_000999925.1.62522 WP_000999925.1.62536 WP_000999925.1.62640 WP_000999925.1.62686 WP_000999925.1.627 WP_000999925.1.62725 WP_000999925.1.62745 WP_000999925.1.62751 WP_000999925.1.62757 WP_000999925.1.62825 WP_000999925.1.62913 WP_000999925.1.6292 WP_000999925.1.62932 WP_000999925.1.62960 WP_000999925.1.62976 WP_000999925.1.62983 WP_000999925.1.62988 WP_000999925.1.63016 WP_000999925.1.63025 WP_000999925.1.63045 WP_000999925.1.63069 WP_000999925.1.63087 WP_000999925.1.63102 WP_000999925.1.63169 WP_000999925.1.63229 WP_000999925.1.63297 WP_000999925.1.63358 WP_000999925.1.63448 WP_000999925.1.63455 WP_000999925.1.63497 WP_000999925.1.63509 WP_000999925.1.63514 WP_000999925.1.63529 WP_000999925.1.6357 WP_000999925.1.63583 WP_000999925.1.63585 WP_000999925.1.63592 WP_000999925.1.63603 WP_000999925.1.63663 WP_000999925.1.6367 WP_000999925.1.6370 WP_000999925.1.63736 WP_000999925.1.63748 WP_000999925.1.63816 WP_000999925.1.63851 WP_000999925.1.63863 WP_000999925.1.63864 WP_000999925.1.63876 WP_000999925.1.6389 WP_000999925.1.63901 WP_000999925.1.63955 WP_000999925.1.63963 WP_000999925.1.63977 WP_000999925.1.64010 WP_000999925.1.64032 WP_000999925.1.64085 WP_000999925.1.64087 WP_000999925.1.64109 WP_000999925.1.64121 WP_000999925.1.6415 WP_000999925.1.64157 WP_000999925.1.64229 WP_000999925.1.64293 WP_000999925.1.64332 WP_000999925.1.64350 WP_000999925.1.64376 WP_000999925.1.64385 WP_000999925.1.64389 WP_000999925.1.644 WP_000999925.1.64462 WP_000999925.1.64471 WP_000999925.1.64500 WP_000999925.1.64501 WP_000999925.1.64538 WP_000999925.1.64597 WP_000999925.1.64632 WP_000999925.1.64648 WP_000999925.1.64654 WP_000999925.1.64662 WP_000999925.1.64663 WP_000999925.1.64709 WP_000999925.1.64710 WP_000999925.1.64711 WP_000999925.1.64744 WP_000999925.1.64763 WP_000999925.1.64798 WP_000999925.1.64817 WP_000999925.1.64847 WP_000999925.1.6487 WP_000999925.1.64891 WP_000999925.1.64974 WP_000999925.1.65011 WP_000999925.1.65052 WP_000999925.1.65054 WP_000999925.1.65075 WP_000999925.1.6514 WP_000999925.1.65172 WP_000999925.1.65191 WP_000999925.1.65200 WP_000999925.1.65211 WP_000999925.1.65218 WP_000999925.1.65226 WP_000999925.1.65249 WP_000999925.1.65266 WP_000999925.1.65348 WP_000999925.1.65357 WP_000999925.1.65395 WP_000999925.1.65437 WP_000999925.1.65459 WP_000999925.1.65487 WP_000999925.1.6549 WP_000999925.1.65499 WP_000999925.1.6554 WP_000999925.1.65601 WP_000999925.1.6561 WP_000999925.1.65650 WP_000999925.1.65687 WP_000999925.1.65697 WP_000999925.1.65698 WP_000999925.1.65699 WP_000999925.1.65737 WP_000999925.1.65755 WP_000999925.1.65771 WP_000999925.1.65812 WP_000999925.1.65846 WP_000999925.1.65849 WP_000999925.1.65863 WP_000999925.1.65881 WP_000999925.1.65883 WP_000999925.1.65901 WP_000999925.1.6595 WP_000999925.1.65968 WP_000999925.1.65985 WP_000999925.1.66021 WP_000999925.1.66031 WP_000999925.1.66052 WP_000999925.1.66064 WP_000999925.1.66109 WP_000999925.1.66122 WP_000999925.1.66145 WP_000999925.1.66171 WP_000999925.1.66183 WP_000999925.1.6620 WP_000999925.1.66216 WP_000999925.1.66234 WP_000999925.1.66273 WP_000999925.1.66289 WP_000999925.1.66315 WP_000999925.1.66324 WP_000999925.1.6634 WP_000999925.1.66361 WP_000999925.1.66368 WP_000999925.1.66385 WP_000999925.1.66400 WP_000999925.1.66428 WP_000999925.1.66446 WP_000999925.1.66480 WP_000999925.1.66506 WP_000999925.1.66539 WP_000999925.1.66665 WP_000999925.1.66681 WP_000999925.1.66684 WP_000999925.1.66733 WP_000999925.1.66755 WP_000999925.1.66759 WP_000999925.1.66801 WP_000999925.1.66825 WP_000999925.1.66860 WP_000999925.1.66937 WP_000999925.1.66953 WP_000999925.1.66955 WP_000999925.1.66959 WP_000999925.1.66981 WP_000999925.1.67024 WP_000999925.1.67042 WP_000999925.1.67075 WP_000999925.1.6710 WP_000999925.1.67101 WP_000999925.1.67143 WP_000999925.1.67173 WP_000999925.1.67201 WP_000999925.1.67211 WP_000999925.1.67237 WP_000999925.1.67279 WP_000999925.1.67336 WP_000999925.1.67339 WP_000999925.1.67387 WP_000999925.1.67394 WP_000999925.1.67397 WP_000999925.1.67403 WP_000999925.1.67430 WP_000999925.1.67442 WP_000999925.1.67539 WP_000999925.1.67556 WP_000999925.1.67576 WP_000999925.1.6760 WP_000999925.1.67604 WP_000999925.1.67617 WP_000999925.1.67619 WP_000999925.1.67625 WP_000999925.1.67627 WP_000999925.1.67633 WP_000999925.1.67641 WP_000999925.1.67657 WP_000999925.1.67673 WP_000999925.1.67700 WP_000999925.1.67707 WP_000999925.1.67718 WP_000999925.1.67729 WP_000999925.1.67772 WP_000999925.1.67774 WP_000999925.1.6782 WP_000999925.1.67820 WP_000999925.1.67910 WP_000999925.1.67932 WP_000999925.1.67954 WP_000999925.1.68 WP_000999925.1.68043 WP_000999925.1.68105 WP_000999925.1.68113 WP_000999925.1.68115 WP_000999925.1.68131 WP_000999925.1.68140 WP_000999925.1.68147 WP_000999925.1.68159 WP_000999925.1.68182 WP_000999925.1.6819 WP_000999925.1.68285 WP_000999925.1.68359 WP_000999925.1.68420 WP_000999925.1.685 WP_000999925.1.68514 WP_000999925.1.68564 WP_000999925.1.68652 WP_000999925.1.68677 WP_000999925.1.68688 WP_000999925.1.68742 WP_000999925.1.68770 WP_000999925.1.68809 WP_000999925.1.68816 WP_000999925.1.68893 WP_000999925.1.68895 WP_000999925.1.68914 WP_000999925.1.69053 WP_000999925.1.69080 WP_000999925.1.69086 WP_000999925.1.69131 WP_000999925.1.69170 WP_000999925.1.69210 WP_000999925.1.69236 WP_000999925.1.69270 WP_000999925.1.69273 WP_000999925.1.69282 WP_000999925.1.69357 WP_000999925.1.69376 WP_000999925.1.69396 WP_000999925.1.69466 WP_000999925.1.69485 WP_000999925.1.69575 WP_000999925.1.69597 WP_000999925.1.69611 WP_000999925.1.69616 WP_000999925.1.69642 WP_000999925.1.69656 WP_000999925.1.69657 WP_000999925.1.69690 WP_000999925.1.69696 WP_000999925.1.69710 WP_000999925.1.69760 WP_000999925.1.69767 WP_000999925.1.69790 WP_000999925.1.69923 WP_000999925.1.69948 WP_000999925.1.69953 WP_000999925.1.69965 WP_000999925.1.70010 WP_000999925.1.70047 WP_000999925.1.70049 WP_000999925.1.70058 WP_000999925.1.70061 WP_000999925.1.70088 WP_000999925.1.70205 WP_000999925.1.70240 WP_000999925.1.70249 WP_000999925.1.70261 WP_000999925.1.70272 WP_000999925.1.70303 WP_000999925.1.70314 WP_000999925.1.7033 WP_000999925.1.70427 WP_000999925.1.70433 WP_000999925.1.70440 WP_000999925.1.70491 WP_000999925.1.70531 WP_000999925.1.70545 WP_000999925.1.70596 WP_000999925.1.70623 WP_000999925.1.70671 WP_000999925.1.70678 WP_000999925.1.70679 WP_000999925.1.70708 WP_000999925.1.70717 WP_000999925.1.70731 WP_000999925.1.70772 WP_000999925.1.70785 WP_000999925.1.70797 WP_000999925.1.70837 WP_000999925.1.70845 WP_000999925.1.70846 WP_000999925.1.70929 WP_000999925.1.70977 WP_000999925.1.70981 WP_000999925.1.70985 WP_000999925.1.70995 WP_000999925.1.71039 WP_000999925.1.71057 WP_000999925.1.71081 WP_000999925.1.71117 WP_000999925.1.71172 WP_000999925.1.71184 WP_000999925.1.71186 WP_000999925.1.71201 WP_000999925.1.71268 WP_000999925.1.71305 WP_000999925.1.7142 WP_000999925.1.71452 WP_000999925.1.71455 WP_000999925.1.71456 WP_000999925.1.71487 WP_000999925.1.71500 WP_000999925.1.71523 WP_000999925.1.71542 WP_000999925.1.71566 WP_000999925.1.71600 WP_000999925.1.71626 WP_000999925.1.71640 WP_000999925.1.71649 WP_000999925.1.71651 WP_000999925.1.71653 WP_000999925.1.71716 WP_000999925.1.71746 WP_000999925.1.71872 WP_000999925.1.71923 WP_000999925.1.71941 WP_000999925.1.71950 WP_000999925.1.71954 WP_000999925.1.71979 WP_000999925.1.71984 WP_000999925.1.71985 WP_000999925.1.720 WP_000999925.1.72003 WP_000999925.1.72073 WP_000999925.1.72100 WP_000999925.1.72182 WP_000999925.1.72190 WP_000999925.1.72221 WP_000999925.1.72269 WP_000999925.1.72277 WP_000999925.1.72283 WP_000999925.1.72300 WP_000999925.1.72307 WP_000999925.1.72325 WP_000999925.1.72339 WP_000999925.1.72350 WP_000999925.1.72383 WP_000999925.1.7243 WP_000999925.1.72461 WP_000999925.1.72470 WP_000999925.1.72527 WP_000999925.1.72532 WP_000999925.1.7255 WP_000999925.1.72602 WP_000999925.1.72625 WP_000999925.1.72631 WP_000999925.1.72638 WP_000999925.1.72667 WP_000999925.1.72674 WP_000999925.1.72716 WP_000999925.1.72718 WP_000999925.1.72724 WP_000999925.1.72789 WP_000999925.1.72828 WP_000999925.1.72865 WP_000999925.1.72894 WP_000999925.1.72896 WP_000999925.1.72944 WP_000999925.1.7295 WP_000999925.1.72969 WP_000999925.1.72987 WP_000999925.1.73052 WP_000999925.1.73068 WP_000999925.1.7311 WP_000999925.1.73114 WP_000999925.1.73177 WP_000999925.1.73180 WP_000999925.1.73258 WP_000999925.1.73270 WP_000999925.1.73285 WP_000999925.1.7332 WP_000999925.1.73328 WP_000999925.1.7333 WP_000999925.1.73352 WP_000999925.1.73389 WP_000999925.1.73425 WP_000999925.1.73488 WP_000999925.1.73504 WP_000999925.1.7353 WP_000999925.1.73544 WP_000999925.1.73598 WP_000999925.1.7361 WP_000999925.1.73648 WP_000999925.1.73708 WP_000999925.1.7374 WP_000999925.1.73764 WP_000999925.1.73768 WP_000999925.1.73849 WP_000999925.1.73948 WP_000999925.1.73999 WP_000999925.1.74024 WP_000999925.1.74028 WP_000999925.1.74030 WP_000999925.1.74038 WP_000999925.1.74040 WP_000999925.1.74043 WP_000999925.1.74058 WP_000999925.1.74070 WP_000999925.1.74077 WP_000999925.1.74135 WP_000999925.1.74174 WP_000999925.1.74207 WP_000999925.1.74214 WP_000999925.1.74241 WP_000999925.1.74248 WP_000999925.1.74285 WP_000999925.1.743 WP_000999925.1.7430 WP_000999925.1.74300 WP_000999925.1.74317 WP_000999925.1.74415 WP_000999925.1.74578 WP_000999925.1.74616 WP_000999925.1.74621 WP_000999925.1.74647 WP_000999925.1.74677 WP_000999925.1.74699 WP_000999925.1.74806 WP_000999925.1.74831 WP_000999925.1.74894 WP_000999925.1.74929 WP_000999925.1.74939 WP_000999925.1.74946 WP_000999925.1.74972 WP_000999925.1.74973 WP_000999925.1.75051 WP_000999925.1.75056 WP_000999925.1.7507 WP_000999925.1.75089 WP_000999925.1.75116 WP_000999925.1.75148 WP_000999925.1.75159 WP_000999925.1.75237 WP_000999925.1.75273 WP_000999925.1.75296 WP_000999925.1.75413 WP_000999925.1.75433 WP_000999925.1.75450 WP_000999925.1.75532 WP_000999925.1.75565 WP_000999925.1.7558 WP_000999925.1.75593 WP_000999925.1.75607 WP_000999925.1.75610 WP_000999925.1.75633 WP_000999925.1.75664 WP_000999925.1.75716 WP_000999925.1.75718 WP_000999925.1.75745 WP_000999925.1.75751 WP_000999925.1.75794 WP_000999925.1.75810 WP_000999925.1.75844 WP_000999925.1.75863 WP_000999925.1.75886 WP_000999925.1.75898 WP_000999925.1.75902 WP_000999925.1.76 WP_000999925.1.76081 WP_000999925.1.76108 WP_000999925.1.76116 WP_000999925.1.76122 WP_000999925.1.76137 WP_000999925.1.76156 WP_000999925.1.76164 WP_000999925.1.76186 WP_000999925.1.76256 WP_000999925.1.7629 WP_000999925.1.76339 WP_000999925.1.76345 WP_000999925.1.76366 WP_000999925.1.76417 WP_000999925.1.76451 WP_000999925.1.7646 WP_000999925.1.76495 WP_000999925.1.76510 WP_000999925.1.76558 WP_000999925.1.76572 WP_000999925.1.76641 WP_000999925.1.76651 WP_000999925.1.76653 WP_000999925.1.7672 WP_000999925.1.76776 WP_000999925.1.76788 WP_000999925.1.76913 WP_000999925.1.76916 WP_000999925.1.76932 WP_000999925.1.76968 WP_000999925.1.76973 WP_000999925.1.76988 WP_000999925.1.77016 WP_000999925.1.77033 WP_000999925.1.77067 WP_000999925.1.77087 WP_000999925.1.77090 WP_000999925.1.77111 WP_000999925.1.77299 WP_000999925.1.77306 WP_000999925.1.77356 WP_000999925.1.77384 WP_000999925.1.77431 WP_000999925.1.77440 WP_000999925.1.77475 WP_000999925.1.77496 WP_000999925.1.77501 WP_000999925.1.77512 WP_000999925.1.77513 WP_000999925.1.77555 WP_000999925.1.77563 WP_000999925.1.77596 WP_000999925.1.77629 WP_000999925.1.77702 WP_000999925.1.77713 WP_000999925.1.7772 WP_000999925.1.77825 WP_000999925.1.77837 WP_000999925.1.77900 WP_000999925.1.7792 WP_000999925.1.77923 WP_000999925.1.7793 WP_000999925.1.77951 WP_000999925.1.77975 WP_000999925.1.77983 WP_000999925.1.77989 WP_000999925.1.7802 WP_000999925.1.78035 WP_000999925.1.78048 WP_000999925.1.78051 WP_000999925.1.78107 WP_000999925.1.78166 WP_000999925.1.78192 WP_000999925.1.78195 WP_000999925.1.78259 WP_000999925.1.78291 WP_000999925.1.78309 WP_000999925.1.78320 WP_000999925.1.78382 WP_000999925.1.78388 WP_000999925.1.78410 WP_000999925.1.78443 WP_000999925.1.78501 WP_000999925.1.78603 WP_000999925.1.7862 WP_000999925.1.78626 WP_000999925.1.78632 WP_000999925.1.78658 WP_000999925.1.78661 WP_000999925.1.78674 WP_000999925.1.78676 WP_000999925.1.78697 WP_000999925.1.78715 WP_000999925.1.78734 WP_000999925.1.78761 WP_000999925.1.7877 WP_000999925.1.78771 WP_000999925.1.78815 WP_000999925.1.78877 WP_000999925.1.78896 WP_000999925.1.789 WP_000999925.1.78951 WP_000999925.1.78993 WP_000999925.1.79011 WP_000999925.1.79012 WP_000999925.1.79069 WP_000999925.1.79074 WP_000999925.1.79081 WP_000999925.1.79098 WP_000999925.1.79099 WP_000999925.1.79155 WP_000999925.1.79164 WP_000999925.1.79204 WP_000999925.1.79280 WP_000999925.1.79289 WP_000999925.1.79397 WP_000999925.1.79456 WP_000999925.1.79468 WP_000999925.1.79532 WP_000999925.1.79547 WP_000999925.1.79580 WP_000999925.1.79586 WP_000999925.1.79654 WP_000999925.1.7970 WP_000999925.1.7972 WP_000999925.1.79722 WP_000999925.1.79757 WP_000999925.1.79772 WP_000999925.1.7982 WP_000999925.1.79880 WP_000999925.1.7991 WP_000999925.1.79910 WP_000999925.1.79916 WP_000999925.1.79929 WP_000999925.1.79934 WP_000999925.1.79945 WP_000999925.1.80065 WP_000999925.1.80103 WP_000999925.1.80249 WP_000999925.1.80254 WP_000999925.1.80273 WP_000999925.1.80282 WP_000999925.1.80307 WP_000999925.1.80354 WP_000999925.1.80368 WP_000999925.1.80380 WP_000999925.1.80386 WP_000999925.1.80400 WP_000999925.1.80441 WP_000999925.1.80462 WP_000999925.1.8049 WP_000999925.1.80492 WP_000999925.1.80569 WP_000999925.1.80609 WP_000999925.1.80638 WP_000999925.1.80664 WP_000999925.1.80696 WP_000999925.1.80760 WP_000999925.1.80819 WP_000999925.1.80827 WP_000999925.1.80874 WP_000999925.1.80876 WP_000999925.1.80927 WP_000999925.1.80984 WP_000999925.1.8106 WP_000999925.1.81067 WP_000999925.1.81109 WP_000999925.1.81110 WP_000999925.1.81131 WP_000999925.1.81187 WP_000999925.1.81197 WP_000999925.1.81225 WP_000999925.1.81231 WP_000999925.1.81262 WP_000999925.1.81268 WP_000999925.1.81269 WP_000999925.1.81271 WP_000999925.1.8130 WP_000999925.1.8131 WP_000999925.1.81333 WP_000999925.1.8134 WP_000999925.1.81342 WP_000999925.1.81364 WP_000999925.1.81388 WP_000999925.1.81409 WP_000999925.1.81455 WP_000999925.1.81494 WP_000999925.1.81548 WP_000999925.1.81557 WP_000999925.1.81668 WP_000999925.1.81676 WP_000999925.1.8168 WP_000999925.1.81681 WP_000999925.1.8170 WP_000999925.1.81743 WP_000999925.1.81746 WP_000999925.1.81763 WP_000999925.1.81768 WP_000999925.1.81855 WP_000999925.1.81921 WP_000999925.1.81931 WP_000999925.1.81936 WP_000999925.1.81949 WP_000999925.1.82070 WP_000999925.1.82076 WP_000999925.1.82131 WP_000999925.1.82149 WP_000999925.1.82156 WP_000999925.1.8218 WP_000999925.1.82180 WP_000999925.1.82201 WP_000999925.1.82214 WP_000999925.1.82225 WP_000999925.1.82258 WP_000999925.1.8236 WP_000999925.1.82369 WP_000999925.1.8240 WP_000999925.1.82401 WP_000999925.1.82408 WP_000999925.1.82416 WP_000999925.1.8242 WP_000999925.1.82420 WP_000999925.1.82434 WP_000999925.1.82456 WP_000999925.1.82465 WP_000999925.1.8247 WP_000999925.1.82473 WP_000999925.1.82474 WP_000999925.1.82530 WP_000999925.1.82553 WP_000999925.1.82569 WP_000999925.1.82636 WP_000999925.1.82646 WP_000999925.1.82670 WP_000999925.1.82731 WP_000999925.1.82812 WP_000999925.1.82850 WP_000999925.1.82872 WP_000999925.1.82886 WP_000999925.1.8294 WP_000999925.1.82959 WP_000999925.1.83005 WP_000999925.1.83006 WP_000999925.1.83007 WP_000999925.1.8304 WP_000999925.1.83128 WP_000999925.1.83180 WP_000999925.1.83204 WP_000999925.1.83221 WP_000999925.1.83229 WP_000999925.1.83235 WP_000999925.1.83252 WP_000999925.1.83290 WP_000999925.1.83331 WP_000999925.1.83333 WP_000999925.1.83354 WP_000999925.1.83356 WP_000999925.1.83360 WP_000999925.1.83382 WP_000999925.1.83558 WP_000999925.1.83657 WP_000999925.1.83677 WP_000999925.1.8375 WP_000999925.1.83923 WP_000999925.1.8399 WP_000999925.1.83994 WP_000999925.1.84 WP_000999925.1.84000 WP_000999925.1.84011 WP_000999925.1.8406 WP_000999925.1.84075 WP_000999925.1.84076 WP_000999925.1.84083 WP_000999925.1.84086 WP_000999925.1.84110 WP_000999925.1.84127 WP_000999925.1.84150 WP_000999925.1.84154 WP_000999925.1.84230 WP_000999925.1.8425 WP_000999925.1.84252 WP_000999925.1.84300 WP_000999925.1.8431 WP_000999925.1.84345 WP_000999925.1.84369 WP_000999925.1.84401 WP_000999925.1.84435 WP_000999925.1.84497 WP_000999925.1.84515 WP_000999925.1.84567 WP_000999925.1.84572 WP_000999925.1.84598 WP_000999925.1.84631 WP_000999925.1.84721 WP_000999925.1.84727 WP_000999925.1.84744 WP_000999925.1.84745 WP_000999925.1.84773 WP_000999925.1.84876 WP_000999925.1.84945 WP_000999925.1.84967 WP_000999925.1.84983 WP_000999925.1.85004 WP_000999925.1.8502 WP_000999925.1.85039 WP_000999925.1.85079 WP_000999925.1.85094 WP_000999925.1.85153 WP_000999925.1.8526 WP_000999925.1.85271 WP_000999925.1.85273 WP_000999925.1.85301 WP_000999925.1.85338 WP_000999925.1.85339 WP_000999925.1.85433 WP_000999925.1.85511 WP_000999925.1.85512 WP_000999925.1.8557 WP_000999925.1.85606 WP_000999925.1.85635 WP_000999925.1.85646 WP_000999925.1.85665 WP_000999925.1.85669 WP_000999925.1.85688 WP_000999925.1.85703 WP_000999925.1.85728 WP_000999925.1.85746 WP_000999925.1.85759 WP_000999925.1.85811 WP_000999925.1.859 WP_000999925.1.8591 WP_000999925.1.85917 WP_000999925.1.8594 WP_000999925.1.85977 WP_000999925.1.85982 WP_000999925.1.860 WP_000999925.1.8605 WP_000999925.1.86084 WP_000999925.1.8610 WP_000999925.1.86138 WP_000999925.1.8614 WP_000999925.1.86156 WP_000999925.1.86157 WP_000999925.1.86159 WP_000999925.1.8616 WP_000999925.1.86240 WP_000999925.1.86323 WP_000999925.1.86342 WP_000999925.1.86347 WP_000999925.1.86380 WP_000999925.1.8640 WP_000999925.1.8642 WP_000999925.1.86426 WP_000999925.1.8647 WP_000999925.1.86489 WP_000999925.1.86514 WP_000999925.1.86530 WP_000999925.1.86610 WP_000999925.1.86663 WP_000999925.1.86699 WP_000999925.1.86744 WP_000999925.1.86770 WP_000999925.1.86794 WP_000999925.1.86800 WP_000999925.1.86811 WP_000999925.1.86815 WP_000999925.1.86902 WP_000999925.1.86915 WP_000999925.1.86945 WP_000999925.1.86989 WP_000999925.1.87023 WP_000999925.1.87034 WP_000999925.1.87038 WP_000999925.1.87041 WP_000999925.1.87136 WP_000999925.1.87148 WP_000999925.1.87155 WP_000999925.1.87187 WP_000999925.1.87258 WP_000999925.1.87265 WP_000999925.1.87293 WP_000999925.1.87346 WP_000999925.1.87370 WP_000999925.1.87420 WP_000999925.1.87484 WP_000999925.1.87500 WP_000999925.1.87528 WP_000999925.1.87560 WP_000999925.1.87583 WP_000999925.1.87584 WP_000999925.1.8760 WP_000999925.1.87600 WP_000999925.1.87609 WP_000999925.1.87612 WP_000999925.1.87615 WP_000999925.1.87653 WP_000999925.1.87659 WP_000999925.1.8767 WP_000999925.1.87698 WP_000999925.1.87706 WP_000999925.1.87712 WP_000999925.1.87739 WP_000999925.1.87741 WP_000999925.1.87742 WP_000999925.1.87760 WP_000999925.1.87852 WP_000999925.1.87905 WP_000999925.1.87933 WP_000999925.1.87936 WP_000999925.1.87949 WP_000999925.1.88025 WP_000999925.1.88026 WP_000999925.1.8805 WP_000999925.1.88052 WP_000999925.1.8806 WP_000999925.1.881 WP_000999925.1.88136 WP_000999925.1.88145 WP_000999925.1.88185 WP_000999925.1.88199 WP_000999925.1.88275 WP_000999925.1.88299 WP_000999925.1.88313 WP_000999925.1.88356 WP_000999925.1.88359 WP_000999925.1.88407 WP_000999925.1.88414 WP_000999925.1.88444 WP_000999925.1.88446 WP_000999925.1.88458 WP_000999925.1.88474 WP_000999925.1.88501 WP_000999925.1.88508 WP_000999925.1.88538 WP_000999925.1.88547 WP_000999925.1.886 WP_000999925.1.88609 WP_000999925.1.88620 WP_000999925.1.88647 WP_000999925.1.88648 WP_000999925.1.88675 WP_000999925.1.88692 WP_000999925.1.88707 WP_000999925.1.88727 WP_000999925.1.88731 WP_000999925.1.88772 WP_000999925.1.88850 WP_000999925.1.88854 WP_000999925.1.8889 WP_000999925.1.88892 WP_000999925.1.88894 WP_000999925.1.88966 WP_000999925.1.88968 WP_000999925.1.88982 WP_000999925.1.88998 WP_000999925.1.89120 WP_000999925.1.89174 WP_000999925.1.89177 WP_000999925.1.89182 WP_000999925.1.89221 WP_000999925.1.89298 WP_000999925.1.89308 WP_000999925.1.89314 WP_000999925.1.89328 WP_000999925.1.89332 WP_000999925.1.89343 WP_000999925.1.89362 WP_000999925.1.89395 WP_000999925.1.8940 WP_000999925.1.89408 WP_000999925.1.89425 WP_000999925.1.89449 WP_000999925.1.8947 WP_000999925.1.89503 WP_000999925.1.89591 WP_000999925.1.89606 WP_000999925.1.8961 WP_000999925.1.89612 WP_000999925.1.89634 WP_000999925.1.89647 WP_000999925.1.89668 WP_000999925.1.89680 WP_000999925.1.89706 WP_000999925.1.89713 WP_000999925.1.89733 WP_000999925.1.89777 WP_000999925.1.89796 WP_000999925.1.89804 WP_000999925.1.89832 WP_000999925.1.89845 WP_000999925.1.89888 WP_000999925.1.89911 WP_000999925.1.8995 WP_000999925.1.89952 WP_000999925.1.90007 WP_000999925.1.9003 WP_000999925.1.9011 WP_000999925.1.90196 WP_000999925.1.90240 WP_000999925.1.90274 WP_000999925.1.90280 WP_000999925.1.90330 WP_000999925.1.90338 WP_000999925.1.90365 WP_000999925.1.90421 WP_000999925.1.90428 WP_000999925.1.90489 WP_000999925.1.90513 WP_000999925.1.90522 WP_000999925.1.90540 WP_000999925.1.90563 WP_000999925.1.90582 WP_000999925.1.90620 WP_000999925.1.90625 WP_000999925.1.90713 WP_000999925.1.90748 WP_000999925.1.90759 WP_000999925.1.90792 WP_000999925.1.90794 WP_000999925.1.90796 WP_000999925.1.90811 WP_000999925.1.90859 WP_000999925.1.90876 WP_000999925.1.9091 WP_000999925.1.90959 WP_000999925.1.90973 WP_000999925.1.90983 WP_000999925.1.91067 WP_000999925.1.91164 WP_000999925.1.91205 WP_000999925.1.91215 WP_000999925.1.91239 WP_000999925.1.91291 WP_000999925.1.91313 WP_000999925.1.91334 WP_000999925.1.9135 WP_000999925.1.9137 WP_000999925.1.91372 WP_000999925.1.91424 WP_000999925.1.91453 WP_000999925.1.91474 WP_000999925.1.91505 WP_000999925.1.91506 WP_000999925.1.91557 WP_000999925.1.91579 WP_000999925.1.91597 WP_000999925.1.91715 WP_000999925.1.91742 WP_000999925.1.91772 WP_000999925.1.91776 WP_000999925.1.91795 WP_000999925.1.9187 WP_000999925.1.91870 WP_000999925.1.91898 WP_000999925.1.91904 WP_000999925.1.91974 WP_000999925.1.92018 WP_000999925.1.92082 WP_000999925.1.92087 WP_000999925.1.92098 WP_000999925.1.92129 WP_000999925.1.92156 WP_000999925.1.92172 WP_000999925.1.9222 WP_000999925.1.92240 WP_000999925.1.92243 WP_000999925.1.92327 WP_000999925.1.92399 WP_000999925.1.92452 WP_000999925.1.92470 WP_000999925.1.92477 WP_000999925.1.92545 WP_000999925.1.92557 WP_000999925.1.92570 WP_000999925.1.92588 WP_000999925.1.926 WP_000999925.1.92628 WP_000999925.1.92633 WP_000999925.1.92649 WP_000999925.1.92659 WP_000999925.1.92676 WP_000999925.1.92705 WP_000999925.1.9271 WP_000999925.1.92734 WP_000999925.1.92754 WP_000999925.1.92806 WP_000999925.1.92810 WP_000999925.1.92823 WP_000999925.1.92890 WP_000999925.1.92926 WP_000999925.1.92929 WP_000999925.1.92987 WP_000999925.1.93007 WP_000999925.1.93022 WP_000999925.1.93076 WP_000999925.1.93103 WP_000999925.1.93105 WP_000999925.1.93111 WP_000999925.1.93121 WP_000999925.1.93168 WP_000999925.1.93184 WP_000999925.1.93215 WP_000999925.1.93221 WP_000999925.1.93223 WP_000999925.1.93239 WP_000999925.1.93302 WP_000999925.1.93322 WP_000999925.1.93350 WP_000999925.1.9336 WP_000999925.1.93387 WP_000999925.1.93410 WP_000999925.1.93469 WP_000999925.1.93511 WP_000999925.1.93512 WP_000999925.1.93524 WP_000999925.1.93577 WP_000999925.1.93604 WP_000999925.1.93635 WP_000999925.1.93657 WP_000999925.1.9374 WP_000999925.1.9375 WP_000999925.1.93754 WP_000999925.1.93780 WP_000999925.1.9380 WP_000999925.1.93809 WP_000999925.1.93828 WP_000999925.1.93837 WP_000999925.1.93842 WP_000999925.1.93843 WP_000999925.1.93875 WP_000999925.1.93909 WP_000999925.1.93919 WP_000999925.1.93938 WP_000999925.1.93984 WP_000999925.1.9399 WP_000999925.1.94017 WP_000999925.1.94056 WP_000999925.1.94070 WP_000999925.1.94079 WP_000999925.1.94097 WP_000999925.1.94107 WP_000999925.1.94142 WP_000999925.1.94215 WP_000999925.1.94303 WP_000999925.1.94365 WP_000999925.1.94383 WP_000999925.1.94390 WP_000999925.1.9440 WP_000999925.1.94415 WP_000999925.1.94473 WP_000999925.1.94492 WP_000999925.1.94510 WP_000999925.1.94527 WP_000999925.1.94573 WP_000999925.1.94579 WP_000999925.1.94586 WP_000999925.1.94593 WP_000999925.1.94598 WP_000999925.1.94649 WP_000999925.1.94650 WP_000999925.1.94659 WP_000999925.1.94662 WP_000999925.1.94670 WP_000999925.1.94700 WP_000999925.1.94745 WP_000999925.1.94782 WP_000999925.1.94815 WP_000999925.1.94820 WP_000999925.1.94835 WP_000999925.1.94849 WP_000999925.1.94850 WP_000999925.1.94851 WP_000999925.1.94864 WP_000999925.1.94952 WP_000999925.1.94983 WP_000999925.1.95006 WP_000999925.1.95055 WP_000999925.1.95076 WP_000999925.1.95094 WP_000999925.1.95099 WP_000999925.1.95136 WP_000999925.1.95165 WP_000999925.1.95239 WP_000999925.1.95246 WP_000999925.1.9525 WP_000999925.1.95255 WP_000999925.1.95265 WP_000999925.1.9527 WP_000999925.1.95338 WP_000999925.1.95412 WP_000999925.1.95434 WP_000999925.1.95447 WP_000999925.1.95456 WP_000999925.1.95530 WP_000999925.1.95547 WP_000999925.1.95558 WP_000999925.1.95590 WP_000999925.1.95607 WP_000999925.1.95625 WP_000999925.1.95656 WP_000999925.1.95675 WP_000999925.1.95716 WP_000999925.1.9574 WP_000999925.1.95757 WP_000999925.1.95776 WP_000999925.1.95805 WP_000999925.1.9586 WP_000999925.1.95866 WP_000999925.1.95884 WP_000999925.1.95890 WP_000999925.1.95906 WP_000999925.1.95963 WP_000999925.1.96025 WP_000999925.1.96044 WP_000999925.1.96045 WP_000999925.1.96054 WP_000999925.1.96094 WP_000999925.1.96107 WP_000999925.1.96127 WP_000999925.1.96141 WP_000999925.1.96144 WP_000999925.1.96188 WP_000999925.1.96190 WP_000999925.1.96211 WP_000999925.1.96212 WP_000999925.1.9624 WP_000999925.1.96319 WP_000999925.1.9633 WP_000999925.1.96340 WP_000999925.1.96348 WP_000999925.1.96349 WP_000999925.1.96359 WP_000999925.1.96380 WP_000999925.1.96490 WP_000999925.1.96521 WP_000999925.1.96533 WP_000999925.1.96537 WP_000999925.1.96539 WP_000999925.1.96552 WP_000999925.1.96584 WP_000999925.1.96588 WP_000999925.1.96610 WP_000999925.1.96625 WP_000999925.1.96635 WP_000999925.1.9664 WP_000999925.1.96640 WP_000999925.1.96675 WP_000999925.1.9670 WP_000999925.1.96735 WP_000999925.1.96750 WP_000999925.1.96792 WP_000999925.1.96801 WP_000999925.1.96803 WP_000999925.1.96876 WP_000999925.1.96925 WP_000999925.1.96938 WP_000999925.1.96946 WP_000999925.1.96957 WP_000999925.1.96978 WP_000999925.1.96993 WP_000999925.1.97026 WP_000999925.1.97028 WP_000999925.1.97079 WP_000999925.1.97103 WP_000999925.1.97154 WP_000999925.1.97184 WP_000999925.1.97260 WP_000999925.1.97287 WP_000999925.1.97291 WP_000999925.1.97322 WP_000999925.1.97328 WP_000999925.1.97368 WP_000999925.1.97422 WP_000999925.1.97441 WP_000999925.1.97497 WP_000999925.1.97505 WP_000999925.1.97534 WP_000999925.1.97547 WP_000999925.1.97599 WP_000999925.1.97606 WP_000999925.1.97615 WP_000999925.1.97628 WP_000999925.1.97646 WP_000999925.1.97648 WP_000999925.1.97656 WP_000999925.1.97690 WP_000999925.1.97693 WP_000999925.1.97704 WP_000999925.1.9774 WP_000999925.1.97768 WP_000999925.1.97819 WP_000999925.1.97840 WP_000999925.1.9793 WP_000999925.1.97938 WP_000999925.1.97981 WP_000999925.1.97986 WP_000999925.1.97991 WP_000999925.1.98036 WP_000999925.1.98080 WP_000999925.1.98086 WP_000999925.1.9811 WP_000999925.1.98119 WP_000999925.1.98158 WP_000999925.1.98201 WP_000999925.1.98263 WP_000999925.1.98338 WP_000999925.1.98418 WP_000999925.1.98438 WP_000999925.1.98440 WP_000999925.1.98448 WP_000999925.1.98457 WP_000999925.1.98472 WP_000999925.1.9850 WP_000999925.1.98502 WP_000999925.1.98570 WP_000999925.1.98607 WP_000999925.1.98726 WP_000999925.1.98731 WP_000999925.1.98762 WP_000999925.1.9877 WP_000999925.1.98801 WP_000999925.1.98818 WP_000999925.1.9899 WP_000999925.1.99057 WP_000999925.1.99097 WP_000999925.1.99107 WP_000999925.1.99163 WP_000999925.1.99164 WP_000999925.1.99215 WP_000999925.1.99219 WP_000999925.1.99255 WP_000999925.1.99327 WP_000999925.1.99335 WP_000999925.1.99350 WP_000999925.1.99360 WP_000999925.1.99363 WP_000999925.1.99369 WP_000999925.1.99388 WP_000999925.1.99397 WP_000999925.1.99456 WP_000999925.1.99463 WP_000999925.1.99469 WP_000999925.1.99483 WP_000999925.1.99490 WP_000999925.1.99493 WP_000999925.1.99546 WP_000999925.1.99577 WP_000999925.1.99579 WP_000999925.1.99595 WP_000999925.1.99613 WP_000999925.1.99630 WP_000999925.1.99671 WP_000999925.1.99676 WP_000999925.1.99764 WP_000999925.1.99829 WP_000999925.1.99837 WP_000999925.1.99841 WP_000999925.1.9992 WP_000999925.1.99924 WP_000999925.1.99961 WP_000999925.1.99996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]